GapMind for catabolism of small carbon sources

 

Protein WP_061534057.1 in Collimonas arenae Ter10

Annotation: NCBI__GCF_001584165.1:WP_061534057.1

Length: 404 amino acids

Source: GCF_001584165.1 in NCBI

Candidate for 15 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism HSERO_RS00890 hi ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale) 82% 99% 655.2 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-isoleucine catabolism livM hi ABC transporter ATP-binding protein (characterized, see rationale) 60% 97% 451.4 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 132.1
L-leucine catabolism livM hi ABC transporter ATP-binding protein (characterized, see rationale) 60% 97% 451.4 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 132.1
L-phenylalanine catabolism livM hi ABC transporter ATP-binding protein (characterized, see rationale) 60% 97% 451.4 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 132.1
L-serine catabolism Ac3H11_1694 hi ABC transporter ATP-binding protein (characterized, see rationale) 60% 97% 451.4 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-tyrosine catabolism Ac3H11_1694 hi ABC transporter ATP-binding protein (characterized, see rationale) 60% 97% 451.4 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-arginine catabolism braE med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 42% 71% 249.2 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-glutamate catabolism braE med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 42% 71% 249.2 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-histidine catabolism braE med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 42% 71% 249.2 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-valine catabolism livM med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 42% 71% 249.2 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 132.1
D-alanine catabolism AZOBR_RS08240 lo Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale) 38% 64% 203.8 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-proline catabolism AZOBR_RS08240 lo Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale) 38% 64% 203.8 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-alanine catabolism braE lo High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 35% 81% 184.1 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-serine catabolism braE lo High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 35% 81% 184.1 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7
L-threonine catabolism braE lo High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 35% 81% 184.1 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 37% 190.7

Sequence Analysis Tools

View WP_061534057.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MANFFDTKKNPTKAYTSLVALTILFMIFPFIAANFGNSWVRIMDFALLYIMLALGLNIVV
GFAGLLDLGYIAFYAIGAYMTGLLASPQFASVLESFVNTYPAIGNFLVMICGPEIVQNGI
HLSLWVIVPLGAALAGMFGAILGAPTLKLRGDYLAIVTLGFGEIIRIFMNNLNAPVNITN
GPQGINLIDPIRIFGVSLAGERGSNATVYFGGFGMPSVNAYYFLFLVLCIAIIFISIRLQ
NSRLGRAWVAIREDEIAAKAMGINTRNMKLLAFSMGASFGGIAGAMFASFQGFVSPESFS
LTESIAVLAMVVLGGMGHIPGVVLGGILLAALPEVLRHTVEPMQMAMFGKVLIDAEVLRQ
LLYGLAMVVIMLTRPAGLWPAPKHEDRPDADIDKPALATGVVEA

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory