Align protocatechuate 3,4-dioxygenase type II α subunit (EC 1.13.11.3) (characterized)
to candidate WP_061532180.1 CAter10_RS02685 hypothetical protein
Query= metacyc::MONOMER-14209 (195 letters) >NCBI__GCF_001584165.1:WP_061532180.1 Length = 172 Score = 82.0 bits (201), Expect = 5e-21 Identities = 57/186 (30%), Positives = 89/186 (47%), Gaps = 20/186 (10%) Query: 9 ITPSQTVGPFYAYCLSPVNYKFRMLASNSLVTKDVDGKHITLRGTVLDGDGLPVPDALIE 68 IT SQT+GPF +++ + ASN+L++ +T+ G + DG+G P+ D IE Sbjct: 5 ITTSQTIGPFPHEA-----WRWGVDASNALIS---GAPTVTISGVIRDGNGAPISDGWIE 56 Query: 69 IWQPDGLGRFSGHHPLLKTAEFKGFGRAMCDALGLFSFETVKPGGAPMRDGVIQAPHVAV 128 W PD + S GF R + G F E P A V+ A Sbjct: 57 AWLPDAVAAESAQ-------AIPGFRRIPSNDDGAFCIEVSLPTPATAGKPVLFA----- 104 Query: 129 SIFGKGLNRHLYTRVYFDDEEANKSDPVLNSIPEDLRSKLIAKEIEPDCYEISIRLQGEG 188 +IF +GL +H +T V+ +D+ +L + D R+ LIA+++ Y I +Q + Sbjct: 105 TIFARGLVKHQFTAVFLEDDSGLAQSEILAQVLADRRATLIARKLGDAQYHWDIWMQSDK 164 Query: 189 ESVFFD 194 E+VFFD Sbjct: 165 ETVFFD 170 Lambda K H 0.320 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 98 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 195 Length of database: 172 Length adjustment: 19 Effective length of query: 176 Effective length of database: 153 Effective search space: 26928 Effective search space used: 26928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory