Align 3-oxopimeloyl-CoA:CoA acetyltransferase (characterized)
to candidate WP_061532096.1 CAter10_RS02100 acetyl-CoA C-acyltransferase family protein
Query= metacyc::MONOMER-20679 (395 letters) >NCBI__GCF_001584165.1:WP_061532096.1 Length = 396 Score = 255 bits (651), Expect = 2e-72 Identities = 170/406 (41%), Positives = 226/406 (55%), Gaps = 33/406 (8%) Query: 3 EAVIVSTARTPIGKAYRGALNATEGATLLGHAIEHAVKRAGIDPKEVEDVVMGAAMQQGA 62 E VIV ART IG +Y GAL L A++ A RAG+DP + ++ G + A Sbjct: 6 EVVIVGAARTAIG-SYGGALKDFAPGELGAIAVKEAFARAGVDPLQAGQIIFGNVIHTEA 64 Query: 63 TGGNIARKALLRAGLPVTTAGTTIDRQCASGLQAIALAARSVLFDGVEIAVGGGGESISL 122 ++R L AG+ + T++R C SGLQAI AA ++ ++AVGGG ES+S Sbjct: 65 RDMYVSRVVGLNAGMGKESTALTLNRLCGSGLQAIITAANAIQLGETDVAVGGGVESMSR 124 Query: 123 VQ--------NDKMNTFHAVDPALEAIK---GDVYMAMLDTAETVAKRYGISRERQDEYS 171 +M VD + A+ G +M + TAE VA++YGISRE QD ++ Sbjct: 125 SMYATQAARWGARMGDIKMVDMMVGALSDPFGAGHMGI--TAENVAEKYGISREEQDAFA 182 Query: 172 LESQRRTAAAQQGGKFNDEIAPISTKMGVVDKATGAVSFKDITL-SQDEGPRPETTAEGL 230 LESQRR AA G F +I P+ K + K +TL DE P+ + T E L Sbjct: 183 LESQRRATAAIAAGHFKSQIVPVEIK-----------TRKGVTLFDTDEYPKADATMESL 231 Query: 231 AGLK-AVRGEGFTITAGNASQLSDGASATVIMSDKTAAAKGLKPLGIFRGMVSYGC---E 286 A LK A + EG T+TAGNAS ++DGA+A V+M+ AA GLKPL +VSYG + Sbjct: 232 AKLKPAFKKEGGTVTAGNASGINDGAAACVLMAADAAAQAGLKPLA---RVVSYGVAGVD 288 Query: 287 PDEMGIGPVFAVPRLLKRHGLSVDDIGLWELNEAFAVQVLYCRDKLGIDPEKLNVNGGAI 346 P MG GP+ AV LKR GL + D+ + E NEAFA Q L LG+DP NVNGGAI Sbjct: 289 PTIMGTGPIPAVQLALKRAGLHLSDMEVIESNEAFAAQSLGVCKGLGLDPALTNVNGGAI 348 Query: 347 SVGHPYGMSGARLAGHALIEGRRRKAKYAVVTMCVGGGMGSAGLFE 392 ++GHP G SGA +A L E R +Y ++TMC+GGG G A + E Sbjct: 349 ALGHPLGASGAIIAVKCLYELIRTNKRYGLITMCIGGGQGIALIIE 394 Lambda K H 0.316 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 478 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 396 Length adjustment: 31 Effective length of query: 364 Effective length of database: 365 Effective search space: 132860 Effective search space used: 132860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory