Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate WP_061534651.1 CAter10_RS19010 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >NCBI__GCF_001584165.1:WP_061534651.1 Length = 231 Score = 127 bits (318), Expect = 4e-34 Identities = 70/209 (33%), Positives = 118/209 (56%), Gaps = 8/209 (3%) Query: 157 GLMLTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVM 216 G+ TL + V ++G + G VLA+ R S+ I V +++ R VPL+ V+F + Sbjct: 21 GMKFTLTLTVVAMIGGILFGTVLAMMRLSHNKVISFVATSYVNLIRSVPLVLVIFWFYFL 80 Query: 217 LPLF------LPEGMNFDKLLRALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLG 270 +P + + ALI ILF++AY E++R G+Q+IP+GQ A A+G+ Sbjct: 81 VPFIGAWITGASQPVQVGAFSSALITFILFEAAYYCEIMRSGIQSIPRGQISAGYALGMN 140 Query: 271 YWRSMGLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMA 330 YW+ MG V+LPQA + +IP ++ I LF+D SLV ++G + + V A+ + G Sbjct: 141 YWQMMGNVVLPQAFRNMIPILLTQTIVLFQDVSLVYVLG--SVPDFVTVASKIAQRDGRL 198 Query: 331 TEGYVFAALVFWIFCFGMSRYSMHLERKL 359 E Y+F A+V+++ FG+S L++++ Sbjct: 199 VEMYMFVAVVYFVMSFGLSTLVKKLQQRV 227 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 231 Length adjustment: 26 Effective length of query: 339 Effective length of database: 205 Effective search space: 69495 Effective search space used: 69495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory