Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_061534056.1 CAter10_RS15135 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >NCBI__GCF_001584165.1:WP_061534056.1 Length = 256 Score = 187 bits (476), Expect = 2e-52 Identities = 118/267 (44%), Positives = 160/267 (59%), Gaps = 18/267 (6%) Query: 9 MSDDTLLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTM 68 MS T+L + ++ +FGGL A+++ + + +G I LIGPNGAGKTT FN ITG Y+ Sbjct: 1 MSAPTILSISGVNKRFGGLQALSEVNIQILKGQIYGLIGPNGAGKTTFFNVITGLYQADT 60 Query: 69 GMITFNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENLLVAQHNKLMKAS 128 G TF + +GK Y + +A +ARTFQNIRLF +TVLEN++V H + Sbjct: 61 G--TF-ELAGKPYSPSAPHE---VAKAGIARTFQNIRLFGEMTVLENVMVGCHVR----- 109 Query: 129 GYTILGLIG-VGPYKREAAEAIELARFWLEKADLID---RADDPAGDLPYGAQRRLEIAR 184 T G+ G V +K AE + R E D + D A L YG QRRLEIAR Sbjct: 110 --TRQGVFGAVFRHKAARAEEAAIRRRSQELLDFVGIGRFGDRTARHLSYGDQRRLEIAR 167 Query: 185 AMCTGPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVV 244 A+ T P+LL LDEPAAG+N E L LL I+ E G +ILLIEHD+ ++M + D + V Sbjct: 168 ALATEPQLLALDEPAAGMNATEKLALRELLVKIKNE-GKTILLIEHDVKLMMGLCDRLTV 226 Query: 245 LEYGQKISDGTPDHVKNDPRVIAAYLG 271 L+YG+ I++G P ++ +P VI AYLG Sbjct: 227 LDYGKPIAEGLPAEIQKNPAVIEAYLG 253 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 256 Length adjustment: 25 Effective length of query: 267 Effective length of database: 231 Effective search space: 61677 Effective search space used: 61677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory