Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_061533628.1 CAter10_RS12275 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_001584165.1:WP_061533628.1 Length = 241 Score = 218 bits (555), Expect = 9e-62 Identities = 113/246 (45%), Positives = 167/246 (67%), Gaps = 14/246 (5%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVF 70 +L ++ + YG + L G+ + V KG++V+LIG+NGAGK+T M I G +A+ G+V Sbjct: 1 MLSISNLHAAYGKVEVLHGISLEVPKGKVVTLIGSNGAGKTTTMRAISGMIKAKAGNVTL 60 Query: 71 EGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAE--------- 121 G D+T + +H+IAR +A SPEGRR+F M+V++NL +GA F Sbjct: 61 AGVDVTGLDSHKIARAGLAHSPEGRRVFATMSVVDNLLLGA----FPRFTRSRPRGDIKL 116 Query: 122 DVEKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKG 181 D+E+ LFPRLKER Q GTLSGGEQQML++ RA+M P+++LLDEPS+GLAP++V+ Sbjct: 117 DLERALELFPRLKERQHQLAGTLSGGEQQMLAMARAVMLNPEVILLDEPSMGLAPILVEE 176 Query: 182 IFEAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAY 241 +F I +L +AEG+T+ LVEQ A AAL ++ YV+ NG++++ G ++L +P V+AAY Sbjct: 177 VFRIISRL-KAEGVTMLLVEQFAAAALHVADYGYVLENGRISVHGPAEKLKNDPAVKAAY 235 Query: 242 LEGGRH 247 L GG+H Sbjct: 236 LGGGQH 241 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 241 Length adjustment: 24 Effective length of query: 223 Effective length of database: 217 Effective search space: 48391 Effective search space used: 48391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory