Align ABC transporter for L-aspartate, L-asparagine, L-glutamate, and L-glutamine, permease component 2 (characterized)
to candidate WP_061534651.1 CAter10_RS19010 amino acid ABC transporter permease
Query= reanno::pseudo3_N2E3:AO353_16285 (248 letters) >NCBI__GCF_001584165.1:WP_061534651.1 Length = 231 Score = 134 bits (338), Expect = 1e-36 Identities = 74/217 (34%), Positives = 131/217 (60%), Gaps = 7/217 (3%) Query: 25 FITGLGWTIAIAIVAWIIALMLGSVLGVMRTVPNRLVSGIATCYVELFRNVPLLVQLFIW 84 F TG+ +T+ + +VA I ++ G+VL +MR N+++S +AT YV L R+VPL++ +F + Sbjct: 18 FTTGMKFTLTLTVVAMIGGILFGTVLAMMRLSHNKVISFVATSYVNLIRSVPLVLVIFWF 77 Query: 85 YFLVPDLLPQNLQDWYKQDLNPT-TSAYLSVVVCLGLFTAARVCEQVRTGIQALPRGQES 143 YFLVP + W P A+ S ++ LF AA CE +R+GIQ++PRGQ S Sbjct: 78 YFLVPFI-----GAWITGASQPVQVGAFSSALITFILFEAAYYCEIMRSGIQSIPRGQIS 132 Query: 144 AARAMGFKLPQIYWNVLLPQAYRIVIPPLTSEFLNVFKNSSVASLIG-LMELLAQTKQTA 202 A A+G Q+ NV+LPQA+R +IP L ++ + +F++ S+ ++G + + + + A Sbjct: 133 AGYALGMNYWQMMGNVVLPQAFRNMIPILLTQTIVLFQDVSLVYVLGSVPDFVTVASKIA 192 Query: 203 EFSANLFEAFTLATLIYFTLNMSLMLLMRMVEKKVAV 239 + L E + ++YF ++ L L++ ++++VA+ Sbjct: 193 QRDGRLVEMYMFVAVVYFVMSFGLSTLVKKLQQRVAI 229 Lambda K H 0.326 0.139 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 231 Length adjustment: 23 Effective length of query: 225 Effective length of database: 208 Effective search space: 46800 Effective search space used: 46800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory