Align aerobic C4-dicarboxylate transport protein (characterized)
to candidate WP_061532762.1 CAter10_RS06405 C4-dicarboxylate transporter DctA
Query= CharProtDB::CH_014038 (428 letters) >NCBI__GCF_001584165.1:WP_061532762.1 Length = 441 Score = 453 bits (1165), Expect = e-132 Identities = 226/417 (54%), Positives = 304/417 (72%), Gaps = 3/417 (0%) Query: 6 FKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTGIAGME 65 +KSL+ QVL A+ IGI +G YP+ GE +KPLGDGF+KL+KMII ++FC VV GI G Sbjct: 5 YKSLFGQVLIALVIGIAVGVLYPKFGESLKPLGDGFIKLVKMIIPMIVFCVVVNGIYGAG 64 Query: 66 SMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY---AD 122 +K VGR G AL+YFE+V+T+AL++GL++ V PG GMN++P TLDA A++ Y A Sbjct: 65 ELKKVGRVGLKALIYFEVVTTVALVLGLLLAFVFHPGVGMNINPDTLDANALSSYVETAK 124 Query: 123 QAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIESFS 182 Q K G F+M +IP +V+ AF SG++LQVLLF+++FG AL +G K I V+ S S Sbjct: 125 QVKGTGFADFVMKIIPNTVVSAFTSGDVLQVLLFSIIFGSALSLIGEKAAPIVTVVHSMS 184 Query: 183 QVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGSIA 242 + F ++ I+RLAP+G FGA+AFT+GKYGVG+L QLG L+I ++ ++FV +LG+I Sbjct: 185 EAFFKCMSFIIRLAPLGVFGAIAFTVGKYGVGSLQQLGFLVILYFFAVVIFVFAILGTIL 244 Query: 243 KATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSFNL 302 + GFSIFK I+Y+R ELL+VL T+SS+S LP+++ K+E +G + S VGLVIPTGYSFNL Sbjct: 245 RLAGFSIFKLIKYLRAELLVVLATASSDSVLPQIMRKLEYMGIKGSTVGLVIPTGYSFNL 304 Query: 303 DGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSAVG 362 D SIYLT+AAVFIAQATN+ + I + +L V L++SKGA GV GS ++LAATLSA+ Sbjct: 305 DAFSIYLTLAAVFIAQATNTPLAITDLLAILAVALITSKGAHGVPGSAIVILAATLSAIP 364 Query: 363 HLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLNNRAP 419 +PV GL L+L ID FM ARAL NL+GN VAT+VVA W K++D + VLN P Sbjct: 365 AIPVVGLVLVLSIDWFMGIARALGNLLGNCVATVVVAVWEKDIDRARAHAVLNGARP 421 Lambda K H 0.327 0.142 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 572 Number of extensions: 34 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 441 Length adjustment: 32 Effective length of query: 396 Effective length of database: 409 Effective search space: 161964 Effective search space used: 161964 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory