Align NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized)
to candidate WP_061532395.1 CAter10_RS04090 amino acid ABC transporter permease
Query= TCDB::Q8YPM8 (308 letters) >NCBI__GCF_001584165.1:WP_061532395.1 Length = 247 Score = 129 bits (323), Expect = 9e-35 Identities = 75/232 (32%), Positives = 127/232 (54%), Gaps = 22/232 (9%) Query: 82 GLINSLRIAFVGIILTTIVGILAGIARLSD------NW---LVRNISLVYVEIFRNTPLL 132 G +L++A + II+ TI+G+L G+ RL+D W LV+ ++ YV FR TPL Sbjct: 18 GFFMTLQVAVISIIIGTIIGLLLGMLRLADVKHGPWKWPFRLVKGLASFYVAFFRGTPLF 77 Query: 133 LQLLFWYFAVFLGLPRADNKISLGGFIGLSQNGLELPWFTFSPEFSALLLGLIFYT---G 189 +Q+L +FAV L DN + + G + T ++ A + G++ + G Sbjct: 78 VQILLIHFAVMPVLIHQDNGLLISGELAR----------TIKQDYGAFISGIVALSLNAG 127 Query: 190 AFIAEIVRGGIQSVSKGQWEAGRSLGLNPSLIMRLVIFPQALRVIIPPLTSQYLNLTKNS 249 A+I+EI R GIQS+ +GQ A SLG+ L MR V+ PQA R ++PPL ++ + L K+S Sbjct: 128 AYISEIFRAGIQSIDRGQTYAASSLGMGYKLTMRYVVLPQAFRRMLPPLGNEAITLLKDS 187 Query: 250 SLAIAIGYPDIYFVASTTFNQTGKAVEVMLLLMLTYLSLSLTISLIMNAFNR 301 SL AIG ++ + A T + E + + + Y S+++ +++++ + Sbjct: 188 SLVSAIGLAELAYAARTVAGAYSRYWEPYITISVVYFSMTMVLAMLVGRLEK 239 Lambda K H 0.328 0.143 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 247 Length adjustment: 25 Effective length of query: 283 Effective length of database: 222 Effective search space: 62826 Effective search space used: 62826 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory