Align Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)
to candidate WP_061532395.1 CAter10_RS04090 amino acid ABC transporter permease
Query= uniprot:A0A0H3PA28 (219 letters) >NCBI__GCF_001584165.1:WP_061532395.1 Length = 247 Score = 110 bits (276), Expect = 2e-29 Identities = 73/230 (31%), Positives = 119/230 (51%), Gaps = 30/230 (13%) Query: 14 MQGLFLTLKIALATCIISIVFGTFLAITK---------NYGDRLSKFLAACYIDIFRNTP 64 ++G F+TL++A+ + II + G L + + + RL K LA+ Y+ FR TP Sbjct: 16 VKGFFMTLQVAVISIIIGTIIGLLLGMLRLADVKHGPWKWPFRLVKGLASFYVAFFRGTP 75 Query: 65 LLLWMLAACF-VLPVFFGQ-----------------FPQAFWGTIGFSLYTSSVMAEIIR 106 L + +L F V+PV Q + G + SL + ++EI R Sbjct: 76 LFVQILLIHFAVMPVLIHQDNGLLISGELARTIKQDYGAFISGIVALSLNAGAYISEIFR 135 Query: 107 GGLNSIPKGQFEAAYSQGFGKFFTLFYIILPQTFRKIIPALLSQIVTTVKDTAYLAGLGI 166 G+ SI +GQ AA S G G T+ Y++LPQ FR+++P L ++ +T +KD++ ++ +G+ Sbjct: 136 AGIQSIDRGQTYAASSLGMGYKLTMRYVVLPQAFRRMLPPLGNEAITLLKDSSLVSAIGL 195 Query: 167 AELTYNSKTILAKLTSFEEILAMIGVVAGIYFIICFSLSMLVRYYAKKTA 216 AEL Y ++T+ + + E I VV YF + L+MLV KK A Sbjct: 196 AELAYAARTVAGAYSRYWEPYITISVV---YFSMTMVLAMLVGRLEKKYA 242 Lambda K H 0.331 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 247 Length adjustment: 23 Effective length of query: 196 Effective length of database: 224 Effective search space: 43904 Effective search space used: 43904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory