Align Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale)
to candidate WP_061534651.1 CAter10_RS19010 amino acid ABC transporter permease
Query= uniprot:A0A0H3PA28 (219 letters) >NCBI__GCF_001584165.1:WP_061534651.1 Length = 231 Score = 100 bits (248), Expect = 3e-26 Identities = 65/216 (30%), Positives = 113/216 (52%), Gaps = 19/216 (8%) Query: 16 GLFLTLKIALATCIISIVFGTFLAITKNYGDRLSKFLAACYIDIFRNTPLLLWMLAACFV 75 G+ TL + + I I+FGT LA+ + +++ F+A Y+++ R+ PL+L + F+ Sbjct: 21 GMKFTLTLTVVAMIGGILFGTVLAMMRLSHNKVISFVATSYVNLIRSVPLVLVIFWFYFL 80 Query: 76 LP------------VFFGQFPQAFWGTIGFSLYTSSVMAEIIRGGLNSIPKGQFEAAYSQ 123 +P V G F A I F L+ ++ EI+R G+ SIP+GQ A Y+ Sbjct: 81 VPFIGAWITGASQPVQVGAFSSAL---ITFILFEAAYYCEIMRSGIQSIPRGQISAGYAL 137 Query: 124 GFGKFFTLFYIILPQTFRKIIPALLSQIVTTVKDTAYLAGLGIAELTYNSKTILAKLTSF 183 G + + ++LPQ FR +IP LL+Q + +D + + LG + T+ +K+ Sbjct: 138 GMNYWQMMGNVVLPQAFRNMIPILLTQTIVLFQDVSLVYVLGSVP---DFVTVASKIAQR 194 Query: 184 E-EILAMIGVVAGIYFIICFSLSMLVRYYAKKTAYI 218 + ++ M VA +YF++ F LS LV+ ++ A I Sbjct: 195 DGRLVEMYMFVAVVYFVMSFGLSTLVKKLQQRVAII 230 Lambda K H 0.331 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 231 Length adjustment: 22 Effective length of query: 197 Effective length of database: 209 Effective search space: 41173 Effective search space used: 41173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory