Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_061533333.1 CAter10_RS10285 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >NCBI__GCF_001584165.1:WP_061533333.1 Length = 240 Score = 245 bits (626), Expect = 5e-70 Identities = 129/247 (52%), Positives = 174/247 (70%), Gaps = 13/247 (5%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 + V+ L K +G +L+G+ +V+ +IG SGSGKSTFLRC+N LE+ G+IL++ Sbjct: 2 IHVKQLQKNFGRAHILRGIDCDIEESEVVCVIGPSGSGKSTFLRCLNGLEEASGGEILVD 61 Query: 64 NEELKLVANKDGALKAADPK-QLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMS 122 +K DP L MR+ + MVFQ FNL+ HM+ ++N++ AP+ V MS Sbjct: 62 G------------IKVNDPHIDLNAMRAGVGMVFQRFNLFPHMSVLDNLIMAPMQVKKMS 109 Query: 123 KAEAREKAELYLAKVGVSHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDP 182 KA+A AE L KVG+ + DA+P +SGG+QQRVAIARALAMEP+VMLFDEPTSALDP Sbjct: 110 KAQAVLVAEKLLQKVGLLDKIDAFPNQLSGGQQQRVAIARALAMEPKVMLFDEPTSALDP 169 Query: 183 ELVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQS 242 ELVG+VL VM+ALA+EG TMVVVTHEM FAREV++++ F+ +GV+ E G P +VL +P + Sbjct: 170 ELVGEVLAVMKALAEEGMTMVVVTHEMAFAREVADRVFFIDQGVIMEQGPPEQVLGSPHN 229 Query: 243 ERLQQFL 249 ER + FL Sbjct: 230 ERTRDFL 236 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 240 Length adjustment: 24 Effective length of query: 230 Effective length of database: 216 Effective search space: 49680 Effective search space used: 49680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory