Align ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)
to candidate WP_061533926.1 CAter10_RS14310 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A1N7U8S3 (276 letters) >NCBI__GCF_001584165.1:WP_061533926.1 Length = 242 Score = 220 bits (561), Expect = 2e-62 Identities = 122/246 (49%), Positives = 166/246 (67%), Gaps = 12/246 (4%) Query: 27 LQVEGIHKRYGEHEVLKGVSLNARQGDVISLIGASGSGKSTMLRCINFLEQPDAGVITLD 86 + ++ + K +G+++VLKG+ L+ G+VI++IG SGSGKST+LRCIN LE D G I++ Sbjct: 4 IAIDNVKKSFGDNQVLKGIRLDVEPGEVIAIIGKSGSGKSTLLRCINGLESIDEGNISVA 63 Query: 87 GISIEMRQGRAGTRAPHQDQLQNLRTRLAMVFQHFNLWSHMTVLENITMAPRRVLDVSAA 146 G + + +L+ LR ++ M+FQ FNL+ H+TV N+ ++P V S + Sbjct: 64 GSHL----------GKTELELRALRLKVGMIFQQFNLFPHLTVGRNVMLSPMIVKGTSES 113 Query: 147 EAEKRARMYLDKVGLPSRVADQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDPE 206 EA K A+ L +VGL + D YP LSGGQQQRVAIARAL M+P+ +L DE TSALDPE Sbjct: 114 EARKSAQENLARVGLAEKF-DAYPDQLSGGQQQRVAIARALTMQPQALLCDEITSALDPE 172 Query: 207 LVGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVEEHGDAR-ILDQPNSE 265 LV EVL V++ LAEEG T+LMVTHEM FAR+V +V+F+HQG+V E G I P + Sbjct: 173 LVNEVLTVVRGLAEEGMTLLMVTHEMRFAREVCDRVVFMHQGKVHEIGPPEDIFANPKTL 232 Query: 266 RLQQFL 271 LQQFL Sbjct: 233 ELQQFL 238 Lambda K H 0.319 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 242 Length adjustment: 24 Effective length of query: 252 Effective length of database: 218 Effective search space: 54936 Effective search space used: 54936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory