Align deoxynucleoside transporter, permease component 2 (characterized)
to candidate WP_061533693.1 CAter10_RS12720 sugar ABC transporter permease YjfF
Query= reanno::Burk376:H281DRAFT_01112 (364 letters) >NCBI__GCF_001584165.1:WP_061533693.1 Length = 334 Score = 127 bits (320), Expect = 3e-34 Identities = 93/306 (30%), Positives = 153/306 (50%), Gaps = 20/306 (6%) Query: 54 TVALIVVTCLIVGAINPRFFQFATLFDLLHSATTMSLFALGTLVVLASGGIDVSFTAIAA 113 TVAL+V+ + FF + +LL + + A+G V+ SGGID+S ++ A Sbjct: 18 TVALLVLMFGMGSFAYTGFFSLQVILNLLIDNAFLLVIAIGMTFVILSGGIDLSVGSVLA 77 Query: 114 LTMYGITKAVFAW-WPDAPFALILVTGALGGVVLGMVNGLLVHRLKAPSLIVTIGTQYLY 172 LT + +W WP L++ L G G + G L+H K + IVT+ +L Sbjct: 78 LTTMISAYLLQSWHWPPL---LVIACVLLIGSCFGALMGALIHFFKLQAFIVTLAGMFLA 134 Query: 173 RGLLLTFIGTTFFMNIPH----SMDRFGRIPLFFYHTADGLRAVLPVSVLALVAAAVVTW 228 RGL + ++ P S R G + F + P V+A++ A+ + Sbjct: 135 RGLCYLISINSITIDQPLYVELSQARLGILGAF----------ISPSVVIAMLMLALAIY 184 Query: 229 WLLNRTMMGRAVYAMGGSLAIAERLGYNLRAIHLFVFGYTGMLAGIAGILHVSNNRLANP 288 L + T GRAVYA+GG+ A +G + + V+ ++G A +AG+L Sbjct: 185 -LAHYTRFGRAVYAIGGNEQSALLMGLPVGRTKVLVYAFSGFCAALAGVLFSFYMLSGYG 243 Query: 289 FDLVGSELDVIAAVILGGARITGGTGTVVGTLLGVVLVTLIKSVLILVG-VPSTWQKVII 347 G+ELD IAAV++GG ++GG G V GTL GV+++ +I++++ G + S W K++I Sbjct: 244 LHAQGTELDAIAAVVIGGTLLSGGYGYVAGTLTGVLILGVIQTLIAFDGSLSSWWTKIVI 303 Query: 348 GAFILL 353 GA + + Sbjct: 304 GALLFI 309 Lambda K H 0.328 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 334 Length adjustment: 29 Effective length of query: 335 Effective length of database: 305 Effective search space: 102175 Effective search space used: 102175 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory