Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_061533036.1 CAter10_RS08170 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_001584165.1:WP_061533036.1 Length = 254 Score = 101 bits (252), Expect = 1e-26 Identities = 74/252 (29%), Positives = 120/252 (47%), Gaps = 17/252 (6%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAGVA----DVS 67 G R+LI+GAA G+G A A D GA V + D+ ++ +A + VA D++ Sbjct: 10 GRRILITGAARGLGLAFVTAVADAGATVAMADILEDSLQQAVADLQRRGLKVAGFALDLA 69 Query: 68 DCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAV-EDLDPAEWERTIGTNLNSQFYFLR 126 D +++ A LGGLD L+NNA + G E L+ W++ + N+ + Sbjct: 70 DPKSIEQCAAQAIGWLGGLDGLVNNAAVTNSGGRTSEQLEIDMWDKVMNVNVRGTWLMTN 129 Query: 127 KAVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNA 186 + L++ S I+ ++S G Y ASK A++GM +SLA ELG +N+ VNA Sbjct: 130 ACLAALRQ-SGRGSIVNLSSDTPLWGAPNLLAYVASKSAVIGMTRSLARELGGDNITVNA 188 Query: 187 ILPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAG 246 I PG+ E + V R + Y + +++R DV +F S Sbjct: 189 IAPGLTLVEATEYVPQTRHQ-----------VYHDRRAIQRDQLPEDVCGAVIFALSDLS 237 Query: 247 QNISGQAISVDG 258 + +GQ ++V+G Sbjct: 238 RFFTGQVMAVNG 249 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 254 Length adjustment: 24 Effective length of query: 239 Effective length of database: 230 Effective search space: 54970 Effective search space used: 54970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory