Align Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 2.1.2.- (characterized)
to candidate WP_061533943.1 CAter10_RS14415 formate-dependent phosphoribosylglycinamide formyltransferase
Query= SwissProt::P33221 (392 letters) >NCBI__GCF_001584165.1:WP_061533943.1 Length = 403 Score = 438 bits (1126), Expect = e-127 Identities = 240/393 (61%), Positives = 284/393 (72%), Gaps = 8/393 (2%) Query: 4 LGTALRPAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLD 63 LGT L P+AT+VMLLGSGELGKEV I QRLGVEVIAVDRY +AP VAHRSHVINM D Sbjct: 7 LGTPLSPSATKVMLLGSGELGKEVIISLQRLGVEVIAVDRYPNAPGHQVAHRSHVINMAD 66 Query: 64 GDALRRVVELEKPHYIVPEIEAIATDMLIQLEEEG-LNVVPCARATKLTMNREGIRRLAA 122 G AL ++ EKP IVPEIEAIAT+ L+ LE G + V+P ARA LTMNREGIRRLA Sbjct: 67 GAALEALIAQEKPDLIVPEIEAIATETLVALEAAGKVTVIPTARAAWLTMNREGIRRLAG 126 Query: 123 EELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKYAQ 182 E L L TS YRFA++ + + A A+IG+PC++KPVMSSSGKGQ+ I A+++ AW YA Sbjct: 127 ETLALATSPYRFANNLAELKAACAEIGFPCVIKPVMSSSGKGQSKIDGADEVEAAWAYAA 186 Query: 183 QGGRAGAGRVIVEGVVKFDFEITLLTVSAVD-----GVHFCAPVGHRQEDGDYRESWQPQ 237 GGR +GRVIVEG + FD+EITLLTV A++ HFC P+GH Q GDY ESWQP Sbjct: 187 AGGRVDSGRVIVEGFIDFDYEITLLTVRALEQDGSIATHFCEPIGHVQVQGDYVESWQPH 246 Query: 238 QMSPLALERAQEIARKVVLALGGYGLFGVELFVCGDEVIFSEVSPRPHDTGMVTLISQDL 297 M P AL +A++IA+KV LGG GLFGVELFV D V FSEVSPRPHDTGMVT+ SQ Sbjct: 247 PMHPDALLKARDIAKKVTDNLGGLGLFGVELFVKNDMVWFSEVSPRPHDTGMVTMASQQQ 306 Query: 298 SEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAV-GADLQIRLFGKP 356 SEF LH +A LGLPV + PAASAVI Q ++ + F+ V +A+ G + IRLFGKP Sbjct: 307 SEFELHAKAILGLPV-NVALRSPAASAVIYGQHDAKGIAFEGVADAMRGPGVDIRLFGKP 365 Query: 357 EIDGSRRLGVALATAESVVDAIERAKHAAGQVK 389 E RR+GVALATA+ V A RAK AA +VK Sbjct: 366 ESFARRRMGVALATADDVETARTRAKQAAAKVK 398 Lambda K H 0.320 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 403 Length adjustment: 31 Effective length of query: 361 Effective length of database: 372 Effective search space: 134292 Effective search space used: 134292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory