Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate WP_061532690.1 CAter10_RS05915 ABC transporter permease
Query= uniprot:A0A0C4Y7K0 (337 letters) >NCBI__GCF_001584165.1:WP_061532690.1 Length = 348 Score = 224 bits (571), Expect = 2e-63 Identities = 135/339 (39%), Positives = 204/339 (60%), Gaps = 16/339 (4%) Query: 8 PAASTGAPLPAGTLGRLTTQ-----ERLRALGMLPVLVLLCIGFSVLTENFAGWQNLSII 62 P + PL G LG + + R + L +L LL + FS+ + NF NL I Sbjct: 10 PLSHAKLPLSGGVLGSVKARIFHPATRQKLLAFASLLALL-VFFSLASPNFLEIDNLVSI 68 Query: 63 AQQASINMVLAAGMTFVILTGGIDLSVGSILSISAVVAMLVSLMPQLGM-LSVPAALLCG 121 Q ++N VLA TFVI+T GIDLSVG++++ AV+A + L + + + AA+L G Sbjct: 69 LQSTAVNGVLAIACTFVIITAGIDLSVGTLMTFCAVMAGVFLTYWGLPIYVGIAAAILFG 128 Query: 122 LLFGIVNGALVAFMKLPPFIVTLGTLTAVRGLARLVGNDSTIY-NPDIGFAFIGNGEVLG 180 L G V+G L+A +K+PPFI TLG + ++GL+ ++ IY N GF+ I ++G Sbjct: 129 ALCGWVSGVLIAKLKIPPFIATLGMMMLLKGLSLVISGTKPIYFNDTPGFSSISQDSLIG 188 Query: 181 -------VPWLVIIAFAVVAVSWFVLRRTVLGLQIYAVGGNAEAARLSGIKVWVVLLFVY 233 +P V+I F V + L +++ G +A+G N EA RLSG+ V + VY Sbjct: 189 TLIPALPIPNAVLILFLVAIAAGIALNKSIFGRYTFALGSNEEALRLSGVNVDFWKVTVY 248 Query: 234 AVSGLLAGLGGVMSSARLYAANGLQLGQSYELDAIAAVILGGTSFVGGTGSIVGTLVGAL 293 +VSG + G+ G++ ++RL +A LGQ YELDAIAAV++GGTS GGTG+I+GT++GA Sbjct: 249 SVSGAICGIAGLLIASRLNSAQPA-LGQGYELDAIAAVVIGGTSLSGGTGTILGTIIGAF 307 Query: 294 IIAVLSNGLVLLGVSDIWQYIIKGLVIIGAVALDSYRRK 332 I++VL NGL ++ V+ WQ ++ G++II AV +D RR+ Sbjct: 308 IMSVLINGLRMMSVAQEWQTVVTGVIIILAVYMDILRRR 346 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 348 Length adjustment: 29 Effective length of query: 308 Effective length of database: 319 Effective search space: 98252 Effective search space used: 98252 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory