Align Arabinose import ATP-binding protein AraG; EC 7.5.2.12 (characterized, see rationale)
to candidate WP_061533937.1 CAter10_RS14380 D-xylose ABC transporter ATP-binding protein
Query= uniprot:B2SYR5 (512 letters) >NCBI__GCF_001584165.1:WP_061533937.1 Length = 518 Score = 382 bits (980), Expect = e-110 Identities = 225/510 (44%), Positives = 331/510 (64%), Gaps = 25/510 (4%) Query: 5 LRFDNIGKVFPGVRALDGVSFDVNVGQVHGLMGENGAGKSTLLKILGGEYQPDS--GRVM 62 L I K F VRALDG++ V G+ GL GENGAGKSTL+K+L G Y S G ++ Sbjct: 6 LEMKGIVKQFGAVRALDGIALKVRAGECVGLCGENGAGKSTLMKVLSGVYPHGSWEGEIL 65 Query: 63 IDGNEVRFTSAASSIAAGIAVIHQELQYVPDLTVAENLLLG-QLPNSLGWVNK----REA 117 DG ++ S + AAGI +IHQEL VP+L+VAEN+ +G +L G +N R A Sbjct: 66 WDGQPLKAQSIRDTEAAGIVIIHQELMLVPELSVAENIFMGHELTLPGGRMNYPAMYRRA 125 Query: 118 KRFVRE-RLEAMGVALDPNAKLRKLSIAQRQMVEICKALLRNARVIALDEPTSSLSHRET 176 VRE ++ M VAL + + +Q+VEI KAL + AR++ LDEP+SSL+ E Sbjct: 126 DELVRELKMPEMNVALP----VMQYGGGHQQLVEIAKALNKKARLLILDEPSSSLTTSEI 181 Query: 177 EVLFKLVRDLRADNRAMIYISHRMDEIYELCDACTIFRDGRKIASHPTLEGVTRDTIVSE 236 VL ++RDL+A A +YISH++DE+ +CD ++ RDG+ IA+ P E + + I+++ Sbjct: 182 AVLLDIIRDLKAKGVACVYISHKLDEVAAICDTVSVIRDGQHIATTPMQE-LNVEYIIAQ 240 Query: 237 MVGREISDIYNYSARPLGEVRFAAKGIEGHALAQPA-------SFEVRRGEIVGFFGLVG 289 MVGRE++++Y +GEV F A+ I + + PA SF +R+GEI+G GLVG Sbjct: 241 MVGREMNNLYPKQEHAIGEVVFEARHISCYDVDNPARKKVDDISFSLRKGEILGVAGLVG 300 Query: 290 AGRSELMHLVYGA-DHKKGGELLLDGKPIKVRSAGEAIRHGIVLCPEDRKEEGIVAMATV 348 AGR+EL+ +YGA ++ GE+ LDGK + S +++R G+ + PEDRK GIVA V Sbjct: 301 AGRTELVSALYGAYPGRQEGEVWLDGKQVDTGSPMKSLRLGLCMVPEDRKRHGIVADLNV 360 Query: 349 SENINISCRRHYLRVGMFLDRKKEAETADRFIKLLKIKTPSRRQKIRFLSGGNQQKAILS 408 +NI ++ + + R G +D + E +T + I L++KT S I LSGGNQQKA+L+ Sbjct: 361 GQNITLTVLQEFSRFGR-IDAEAELQTIQQQIGKLRLKTASPFLPITSLSGGNQQKAVLA 419 Query: 409 RWL-AEPDLKVVILDEPTRGIDVGAKHEIYNVIYQLAERGCAIVMISSELPEVLGVSDRI 467 + L A+P +V+ILDEPTRG+DVGAK+EIY +++ LAE+G AI+M+SSEL EVLGVSDR+ Sbjct: 420 KMLLAKP--RVLILDEPTRGVDVGAKYEIYKLMFDLAEQGVAIIMVSSELAEVLGVSDRV 477 Query: 468 VVMRQGRISGELTRKDATEQSVLSLALPQS 497 +V+ +G++ G+ + T+++VL+ A+ QS Sbjct: 478 LVIGEGKLRGDFVNQGLTQETVLAAAISQS 507 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 676 Number of extensions: 41 Number of successful extensions: 12 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 512 Length of database: 518 Length adjustment: 35 Effective length of query: 477 Effective length of database: 483 Effective search space: 230391 Effective search space used: 230391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory