Align L-arabinose 1-dehydrogenase; D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_061534005.1 CAter10_RS14785 SDR family oxidoreductase
Query= reanno::acidovorax_3H11:Ac3H11_614 (280 letters) >NCBI__GCF_001584165.1:WP_061534005.1 Length = 263 Score = 332 bits (850), Expect = 7e-96 Identities = 166/252 (65%), Positives = 195/252 (77%), Gaps = 1/252 (0%) Query: 28 LAKFPSLQGRAVFVTGGGSGIGAAIVAAFAEQGARVAFVDVAREASEALAQHIADAGLPR 87 LA FPSL+G++VFVTGGGSGIG AIV+AFAEQGARVAFVD+A EAS AL + AG + Sbjct: 12 LAHFPSLKGKSVFVTGGGSGIGEAIVSAFAEQGARVAFVDIAVEASVALCDRLQAAGFVK 71 Query: 88 PWWRVCDVRDVQALQACMADAAAELGSDFAVLVNNVASDDRHTLESVTPEYYDERMAINE 147 P +R CD+RD+ ALQ+ + D A ELG DF VLVNN A+D RH LE VT E+YD +AIN+ Sbjct: 72 PLFRHCDIRDIAALQSTIRDLAQELG-DFDVLVNNAANDQRHQLEDVTVEFYDNGIAINQ 130 Query: 148 RPAFFAIQAVVPGMRRLGAGSVINLGSTGWQGKGTGYPCYAIAKSSVNGLTRGLAKTLGQ 207 RP FF QAV PGM++ G GS+INL S W GYP Y AKS+V GLTRGLA+ LG Sbjct: 131 RPLFFTCQAVAPGMQKKGGGSIINLSSISWHLSNGGYPVYTTAKSAVIGLTRGLARDLGP 190 Query: 208 DRIRINTVSPGWVMTERQIKLWLDAEGEKELARNQCLPDKLRPHDIARMVLFLASDDAAM 267 IR+NTVSPGWVMTERQI LWLDA GE+++ RNQCLP KL+P +ARMVLFLA+DD+ M Sbjct: 191 HNIRVNTVSPGWVMTERQIALWLDAAGEEDIKRNQCLPGKLQPWHLARMVLFLAADDSVM 250 Query: 268 CTAQEFKVDAGW 279 CTAQEF VDAGW Sbjct: 251 CTAQEFIVDAGW 262 Lambda K H 0.320 0.133 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 263 Length adjustment: 25 Effective length of query: 255 Effective length of database: 238 Effective search space: 60690 Effective search space used: 60690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory