Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate WP_061531810.1 CAter10_RS00185 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >NCBI__GCF_001584165.1:WP_061531810.1 Length = 254 Score = 250 bits (638), Expect = 2e-71 Identities = 130/247 (52%), Positives = 172/247 (69%), Gaps = 10/247 (4%) Query: 15 LLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQILL 74 ++E++ +HK++G EVLKGV L + G VV LIG SGSGK+T+LRC+N LE ++GG+IL+ Sbjct: 1 MIEVKQIHKRFGEHEVLKGVSLQVAAGEVVCLIGPSGSGKSTVLRCINGLETYEGGEILI 60 Query: 75 DGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLHK 134 +GE RV I Q R GM FQ+FNLFPH T L+NV G + V K+ Sbjct: 61 EGE----------RVDSKSSTIHQLRTHVGMVFQRFNLFPHRTVLENVMEGPVYVNKIAP 110 Query: 135 DEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPE 194 A A L++VGL +R D YP QLSGGQQQRVAIARA+AM P +LFDE TSALDPE Sbjct: 111 ATAKKEALALLDKVGLAQRADAYPNQLSGGQQQRVAIARALAMKPKAILFDEPTSALDPE 170 Query: 195 LVGEVLSVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQSP 254 LVGEVL+V++ LA+DGMTM++VTHEM FA +V+D++ F++ G I E+G K++ PQ Sbjct: 171 LVGEVLAVMRNLADDGMTMIVVTHEMGFARDVADRVCFLHSGTIVEEGAAKQVLSAPQHA 230 Query: 255 RLAEFLK 261 R +FL+ Sbjct: 231 RTKDFLR 237 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 254 Length adjustment: 24 Effective length of query: 241 Effective length of database: 230 Effective search space: 55430 Effective search space used: 55430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory