Align Glycerol uptake facilitator protein 3 (characterized)
to candidate WP_061532283.1 CAter10_RS03390 aquaporin family protein
Query= SwissProt::F9UTW9 (240 letters) >NCBI__GCF_001584165.1:WP_061532283.1 Length = 237 Score = 233 bits (594), Expect = 3e-66 Identities = 114/229 (49%), Positives = 155/229 (67%), Gaps = 1/229 (0%) Query: 11 LGEFLGTFILILLGDGVVAGVTLNKSKAQNAGWVAITLGWGFAVTMGVYASSFMSPAHLN 70 L EF+GT +++LLG+GVVA V L+K+ +G + IT+GW AV +GV+ ++ S AHLN Sbjct: 5 LAEFVGTALIVLLGNGVVANVLLSKTHGNGSGLIVITVGWAMAVFVGVFVAASSSGAHLN 64 Query: 71 PAVSLGMAVAGKFPWAYVIPYSAAQIAGGVIGGLVVWLHYYPHWQATKDAGAILGIFATG 130 PAV+L +AVAGKF W V Y +Q+ GG+ G +VWL Y H+ T D L F T Sbjct: 65 PAVTLALAVAGKFAWGSVPAYIVSQMLGGMAGAFLVWLVYRNHFAETSDGNLKLAAFCTA 124 Query: 131 PGIRRYFWNFISEVIGTFVLVFGLLAFTKGQFTAG-LNPIVVGILIIAIGLSLGGTTGYA 189 P IR F N +SEV+GTFVLV+ +L + G L+ + V +L+++IG+SLGGTTGYA Sbjct: 125 PAIRNKFGNIVSEVVGTFVLVYCVLNIASPKMGLGALDALPVALLVMSIGVSLGGTTGYA 184 Query: 190 INPARDLGPRIAHAVLPIANKGTSDWAYSWVPIAGPLVGGALGALLFNV 238 INPARDLGPR+ HA+LPI K SDW Y+ VP+ G + GG L AL++ + Sbjct: 185 INPARDLGPRLMHALLPIPGKRDSDWGYALVPVVGSICGGVLAALVYGL 233 Lambda K H 0.325 0.143 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 237 Length adjustment: 23 Effective length of query: 217 Effective length of database: 214 Effective search space: 46438 Effective search space used: 46438 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory