Align glycerol facilitator-aquaporin (characterized)
to candidate WP_061532283.1 CAter10_RS03390 aquaporin family protein
Query= CharProtDB::CH_012828 (289 letters) >NCBI__GCF_001584165.1:WP_061532283.1 Length = 237 Score = 136 bits (343), Expect = 4e-37 Identities = 91/277 (32%), Positives = 133/277 (48%), Gaps = 50/277 (18%) Query: 9 YITEFVGTALLIIMGNGAVANVELKGTKAHAQSWMIIGWGYGLGVMLPA-VAFGNITSQI 67 Y+ EFVGTAL++++GNG VANV L T + ++I G+ + V + VA + + + Sbjct: 4 YLAEFVGTALIVLLGNGVVANVLLSKTHGNGSGLIVITVGWAMAVFVGVFVAASSSGAHL 63 Query: 68 NPAFTLGLAASGLFPWAHVAQYIIAQVLGAMFGQLLIVMVYRPYYLKTQNPNAILGTFST 127 NPA TL LA +G F W V YI++Q+LG M G L+ +VYR ++ +T + N L F T Sbjct: 64 NPAVTLALAVAGKFAWGSVPAYIVSQMLGGMAGAFLVWLVYRNHFAETSDGNLKLAAFCT 123 Query: 128 IDNVDDNSEKTRLGATINGFLNEFLGSFVLFFGAVAATNIFFGSQSITWMTNYLKGQGAD 187 + + ++E +G+FVL + NI Sbjct: 124 APAIRNK---------FGNIVSEVVGTFVLVY---CVLNI-------------------- 151 Query: 188 VSSSDVMNQIWVQASGASASKMIAHLFLGFLVMGLVVALGGPTGPGLNPARDFGPRLVHS 247 AS + L + LVM + V+LGG TG +NPARD GPRL+H+ Sbjct: 152 -------------ASPKMGLGALDALPVALLVMSIGVSLGGTTGYAINPARDLGPRLMHA 198 Query: 248 LLPKSVLGEAKGSSKWWYAWVPVLAPILASLAAVALF 284 LLP K S W YA VPV+ I + A ++ Sbjct: 199 LLPI----PGKRDSDWGYALVPVVGSICGGVLAALVY 231 Lambda K H 0.323 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 289 Length of database: 237 Length adjustment: 25 Effective length of query: 264 Effective length of database: 212 Effective search space: 55968 Effective search space used: 55968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory