Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_061532931.1 CAter10_RS07525 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_001584165.1:WP_061532931.1 Length = 269 Score = 203 bits (517), Expect = 3e-57 Identities = 106/238 (44%), Positives = 151/238 (63%), Gaps = 2/238 (0%) Query: 17 KGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRVLLDGAPVEGPG 76 + QR A+ + +FV+++GP+GCGKSTLL + AGL ++G V + G P+ G Sbjct: 20 RSQRYTAVADTTLSIAPGEFVSVVGPTGCGKSTLLNVGAGLLQPSTGSVKVFGEPLTGIN 79 Query: 77 AERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGLRGFEQHFPKQL 136 G +FQ+ L PW + QN+ GL+ R EAQ ++ ++A+VGL+GF +P QL Sbjct: 80 RRAGYMFQAEALMPWRSALQNVIAGLQYREADEAQARQLGEEWLARVGLQGFGDRYPHQL 139 Query: 137 SGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAERKTVLFVTHDI 196 SGGM++R A+A+ L DP I+LMDEPF ALD QTR LM+ +L +W A+RK VLF+THD+ Sbjct: 140 SGGMRKRVALAQTLILDPDIILMDEPFSALDIQTRQLMENEVLDLWSAKRKAVLFITHDL 199 Query: 197 DEAIFMANRVAVFSARPGRIKT-ELAVDLPHPRHYT-IKTSPEFMDLKARLTEEIRAE 252 DEAI M++RV V SA PG E +DLP PR I+ P F++L ++ +R E Sbjct: 200 DEAIAMSDRVVVLSAGPGTHPIGEFVIDLPRPRDVAEIRNEPRFVELHQQIWSVLRDE 257 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 269 Length adjustment: 25 Effective length of query: 234 Effective length of database: 244 Effective search space: 57096 Effective search space used: 57096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory