Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_061533525.1 CAter10_RS11575 ATP-binding cassette domain-containing protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_001584165.1:WP_061533525.1 Length = 270 Score = 201 bits (512), Expect = 1e-56 Identities = 102/251 (40%), Positives = 154/251 (61%), Gaps = 6/251 (2%) Query: 4 VSIQAVSRVFETAKGQRTQALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSG 63 + +Q+V V+ TA G+ + L+ + ++ D F ++G SGCGK+TLL ++AG +SG Sbjct: 2 IRLQSVGVVYPTA-GREVEVLRDLSLDLHDGRFTVVIGESGCGKTTLLNLIAGFLQPSSG 60 Query: 64 RVLLDGAPVEGPGAERGMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKV 123 +DG P+ GPGAERG+VFQS TL PW T+ N+ FGLR G Q+ RA ++A Sbjct: 61 SASIDGKPISGPGAERGVVFQSDTLLPWQTVRDNVAFGLRLAGQTLQQRHARADEYLALT 120 Query: 124 GLRGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVLMQELLLGIWE 183 GL+ + +LSGGM+QR ++ARALA DP+ LL+DEP GALD TR MQE LL +W+ Sbjct: 121 GLQAYADAAIWELSGGMRQRVSLARALAVDPRFLLLDEPLGALDALTREQMQEHLLQVWK 180 Query: 184 AERKTVLFVTHDIDEAIFMANRVAVFSARPGRIKTELAVDLPH-----PRHYTIKTSPEF 238 A K + +TH ++EA+F+A + + A PGR+ + +D +IK+ P F Sbjct: 181 ASGKGIFMITHSVEEALFLATDLVLLRAGPGRVDSVRKLDFGERFATGESARSIKSDPHF 240 Query: 239 MDLKARLTEEI 249 + L+ + ++ Sbjct: 241 VGLREEILAQL 251 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 270 Length adjustment: 25 Effective length of query: 234 Effective length of database: 245 Effective search space: 57330 Effective search space used: 57330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory