Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_061534301.1 CAter10_RS16740 ABC transporter ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >NCBI__GCF_001584165.1:WP_061534301.1 Length = 257 Score = 200 bits (509), Expect = 2e-56 Identities = 97/200 (48%), Positives = 137/200 (68%) Query: 30 EVRDNDFVTILGPSGCGKSTLLRIVAGLDHATSGRVLLDGAPVEGPGAERGMVFQSYTLF 89 E+ + + V ++GPSGCGKSTLL + AGL TSG VL DG ++GP ER ++FQ L+ Sbjct: 24 EIEEGELVALVGPSGCGKSTLLHLAAGLGAPTSGAVLADGKHIKGPHPERMLMFQENALY 83 Query: 90 PWLTIEQNIRFGLRERGMPEAQQKERAAYFIAKVGLRGFEQHFPKQLSGGMQQRTAIARA 149 PWLT+E N+ L + + +A + +A ++AKV L+GFE +FP Q+SGGM+QR A+ARA Sbjct: 84 PWLTLEANVALALELQKVGKADARLQARDWLAKVSLQGFETYFPHQVSGGMRQRAALARA 143 Query: 150 LANDPKILLMDEPFGALDNQTRVLMQELLLGIWEAERKTVLFVTHDIDEAIFMANRVAVF 209 PK+LL+DEPFGALD TR+ +Q+ L + ER TVL VTHD+DEA+F+A+R+ VF Sbjct: 144 FITKPKVLLLDEPFGALDALTRMTLQDSLRQLIREERPTVLLVTHDVDEALFLADRILVF 203 Query: 210 SARPGRIKTELAVDLPHPRH 229 S RP ++ E ++ H Sbjct: 204 SPRPAKVLREFNLNHHEKTH 223 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 257 Length adjustment: 24 Effective length of query: 235 Effective length of database: 233 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory