Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_061533926.1 CAter10_RS14310 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9HT70 (335 letters) >NCBI__GCF_001584165.1:WP_061533926.1 Length = 242 Score = 173 bits (438), Expect = 4e-48 Identities = 98/222 (44%), Positives = 134/222 (60%), Gaps = 2/222 (0%) Query: 21 LQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEGLRRF 80 L+ RL+++ G++ +IG SG+GKSTLLR IN LE G I V G + + E LR Sbjct: 19 LKGIRLDVEPGEVIAIIGKSGSGKSTLLRCINGLESIDEGNISVAGSHLGKTELE-LRAL 77 Query: 81 RQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHARKYPA 140 R +VGMIFQ FNL TV N+ + + G S +E E LARVGL++ YP Sbjct: 78 RLKVGMIFQQFNLFPHLTVGRNVMLSPMIVKGTSESEARKSAQENLARVGLAEKFDAYPD 137 Query: 141 QLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITH 200 QLSGGQ+QRV IARAL +P LLCDE TSALDP+ VL ++ + E +T++++TH Sbjct: 138 QLSGGQQQRVAIARALTMQPQALLCDEITSALDPELVNEVLTVVRGLAEE-GMTLLMVTH 196 Query: 201 EMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFV 242 EM R VCD+V M G + E G D+F +P+ ++F+ Sbjct: 197 EMRFAREVCDRVVFMHQGKVHEIGPPEDIFANPKTLELQQFL 238 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 242 Length adjustment: 26 Effective length of query: 309 Effective length of database: 216 Effective search space: 66744 Effective search space used: 66744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory