Align D-methionine ABC transporter membrane protein, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_061533809.1 CAter10_RS13505 ABC transporter permease
Query= TCDB::Q9HT69 (225 letters) >NCBI__GCF_001584165.1:WP_061533809.1 Length = 219 Score = 311 bits (797), Expect = 6e-90 Identities = 152/219 (69%), Positives = 187/219 (85%) Query: 7 MSFANIDWYEIWLASVDTFWMLGGSLLFTVVLGLPLGVLLFLTGPRQMFEQKAVYTLLSL 66 M F+ IDW +IW A+ +T M G SLLFT++LGLPLG+LLF+TG RQ+ EQ+ +Y +LSL Sbjct: 1 MDFSLIDWSDIWQATWETLAMTGFSLLFTILLGLPLGILLFITGKRQLLEQRGIYRVLSL 60 Query: 67 VVNILRSLPFIILLIVMIPLTVLITGTSLGVAGAIPPLVVGATPFFARLVETALREVDKG 126 +VN+LRS+PF+ILLIVMIP+TVL+ GTSLGV GAIPPLV+G PFFARLVE LRE+D+G Sbjct: 61 IVNVLRSVPFLILLIVMIPVTVLLVGTSLGVLGAIPPLVLGTAPFFARLVENVLREIDRG 120 Query: 127 IIEATQAMGASTRQIIWNALLPEARPGIIAAITVTAITLVSYTAMAGVVGAGGLGDLAIR 186 ++EA QAMGAS RQII+ ALLPEA PG+IAA TVTAI L+SY AM+GV+G GGLGDLAIR Sbjct: 121 VVEACQAMGASKRQIIFGALLPEALPGLIAATTVTAIALMSYAAMSGVIGGGGLGDLAIR 180 Query: 187 FGYQRFQTDVMVVTVVMLLILVQILQTVGDKLVVHFSRK 225 FGYQRFQT+VMV TV +L++LVQ+LQ GD+LV HF+RK Sbjct: 181 FGYQRFQTEVMVTTVAVLVVLVQVLQFSGDRLVQHFTRK 219 Lambda K H 0.329 0.143 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 225 Length of database: 219 Length adjustment: 22 Effective length of query: 203 Effective length of database: 197 Effective search space: 39991 Effective search space used: 39991 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory