Align Probable TonB-dependent receptor, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate WP_061534454.1 CAter10_RS17715 MetQ/NlpA family ABC transporter substrate-binding protein
Query= TCDB::Q9HT68 (260 letters) >NCBI__GCF_001584165.1:WP_061534454.1 Length = 267 Score = 238 bits (608), Expect = 7e-68 Identities = 124/259 (47%), Positives = 170/259 (65%), Gaps = 2/259 (0%) Query: 4 LLAAFSAVAALGLTAAQAAES--LTVAATPVPHAEILNVVKPLLAKEGVDLKIKEFTDYV 61 L A S +A+LG A + + + AT PHA+IL VVK + AK+G++++I EF+DYV Sbjct: 9 LFAGLSVIASLGAAAPAFTQDKPIKIGATGGPHAQILEVVKKVAAKDGLNIQIVEFSDYV 68 Query: 62 QPNVQVSEKRLDANFFQHQPYLDEFNKAKGTDLVAVTGVHIEPLGAYSSKYKKLDELPSG 121 QPN ++ LDAN +QH PYL+ K +G LV V P+G YS K K L +L +G Sbjct: 69 QPNAALAAGDLDANSYQHLPYLEAQIKDRGYKLVNVGYTITFPMGVYSKKVKSLKDLKNG 128 Query: 122 ATVVIPNDATNGGRALLLLDKAGVIKLKDNKSITATPKDIVDNPKNIKIRELEAATLPRV 181 A + +PND TNGGRALLLL G++KLK + + ATP DI DNPK +KI E++AA LPR Sbjct: 129 ARIGVPNDPTNGGRALLLLQAQGLLKLKADAGLKATPLDITDNPKKLKIVEIDAAQLPRS 188 Query: 182 LTQVDMALINTNYALEAKLNPTKDALAIEGSDSPYVNILVARPDNKDSDAMQKLAKALHS 241 L +D A IN NYA A L+PTKD +AIEG+ PY N++ R +KD + KL KA HS Sbjct: 189 LDDLDAAAINGNYAESAGLDPTKDGIAIEGAKGPYANVIAVRIADKDKPWVAKLIKAYHS 248 Query: 242 AEIKQFIQEKYKGAVVPAF 260 E+KQ++ ++K +V+PA+ Sbjct: 249 PEVKQYVVTQFKSSVIPAW 267 Lambda K H 0.314 0.131 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 267 Length adjustment: 25 Effective length of query: 235 Effective length of database: 242 Effective search space: 56870 Effective search space used: 56870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory