Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_061534736.1 CAter10_RS19520 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_001584165.1:WP_061534736.1 Length = 252 Score = 180 bits (457), Expect = 2e-50 Identities = 103/239 (43%), Positives = 149/239 (62%), Gaps = 7/239 (2%) Query: 10 PLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQ---ARTG 66 P+L+V + YG + AL G + V G+IV++IG NGAGKST++ I G+ + G Sbjct: 8 PVLEVTDLHVAYGKVEALHGASLQVGAGQIVTVIGPNGAGKSTMLNAIAGAMPNNGSMRG 67 Query: 67 SVVFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLD---NLKHFAEDV 123 +V G+D + + PE R +F MTV +NL +G+ + +A+ + Sbjct: 68 TVRLLGQDTAGVAIETRVARGMCLVPEKRELFASMTVEDNLLLGSYRRYKAGERAYADQM 127 Query: 124 EKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIF 183 ++ LFPRL+ER Q+ G+LSGGE+QML++GRALMA+P+LL+LDEPSLGLAPLIVK IF Sbjct: 128 AVVYDLFPRLQERRKQQAGSLSGGERQMLAVGRALMAKPQLLMLDEPSLGLAPLIVKEIF 187 Query: 184 EAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 I +L + G+ + LVEQNA AAL+ + AYV+ G + + G EL +P+V YL Sbjct: 188 HIIVRLKQT-GVAILLVEQNARAALQAADYAYVLETGDMVLQGPAAELANDPKVIDTYL 245 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 252 Length adjustment: 24 Effective length of query: 223 Effective length of database: 228 Effective search space: 50844 Effective search space used: 50844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory