Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_061534737.1 CAter10_RS19525 branched-chain amino acid ABC transporter ATP-binding protein/permease
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_001584165.1:WP_061534737.1 Length = 601 Score = 169 bits (428), Expect = 1e-46 Identities = 103/256 (40%), Positives = 143/256 (55%), Gaps = 10/256 (3%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 +L + K FGGL AV+ V+ G I GLIGPNGAGK+T+FNL++ + G + F Sbjct: 344 VLEIENARKEFGGLVAVNDISFNVRAGQIVGLIGPNGAGKSTMFNLVTGVLPLTSGTIRF 403 Query: 78 NGD----SIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENML----LADQHQTGEKFLPR 129 I L QI RG RTFQ +++ +TVLEN+ L H Sbjct: 404 RAQRELQQISGLPSRQIVARGIARTFQHVRLMPAMTVLENVAIGAHLRGSHNDVNGIAVS 463 Query: 130 LINFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLIL 189 L+ R EERA +A LE VGLG + AG+L+ GQ+++LE+ARAL +P L+L Sbjct: 464 LLRLNR--NEERALLFEAKQQLERVGLGHLLYEEAGSLALGQQRILEIARALCCDPTLLL 521 Query: 190 LDEPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGT 249 LDEPAAG+ + E + +G++ L++EH+MD +M L + V+ G +A G Sbjct: 522 LDEPAAGLRYQEKQALAELLRKLKAEGMSILLVEHDMDFVMNLTDQLVVMEFGTKIAQGL 581 Query: 250 PEQIQSDPRVLEAYLG 265 P +IQ DP VLEAYLG Sbjct: 582 PAEIQQDPAVLEAYLG 597 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 601 Length adjustment: 31 Effective length of query: 236 Effective length of database: 570 Effective search space: 134520 Effective search space used: 134520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory