Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_061533628.1 CAter10_RS12275 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_001584165.1:WP_061533628.1 Length = 241 Score = 199 bits (505), Expect = 5e-56 Identities = 106/242 (43%), Positives = 155/242 (64%), Gaps = 7/242 (2%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 +L + ++ A Y V +L GI+ + G++VT+IG NGAGK+T + I G++ G + Sbjct: 1 MLSISNLHAAY-GKVEVLHGISLEVPKGKVVTLIGSNGAGKTTTMRAISGMIKAKAGNVT 59 Query: 64 FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLH------QGPTQTLKD 117 G ++TGL S +I R G+ + P+ VF +++V +NL +GAF +G + + Sbjct: 60 LAGVDVTGLDSHKIARAGLAHSPEGRRVFATMSVVDNLLLGAFPRFTRSRPRGDIKLDLE 119 Query: 118 RIYTMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFA 177 R +FP+L +R++Q AGTLSGGE+QMLAM RA+ML+P+++LLDEPS L+PILV++VF Sbjct: 120 RALELFPRLKERQHQLAGTLSGGEQQMLAMARAVMLNPEVILLDEPSMGLAPILVEEVFR 179 Query: 178 QIKAINATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLGAA 237 I + A G ++LVEQ A AL +AD GYVLENGR + G + L NDP V YLG Sbjct: 180 IISRLKAEGVTMLLVEQFAAAALHVADYGYVLENGRISVHGPAEKLKNDPAVKAAYLGGG 239 Query: 238 YH 239 H Sbjct: 240 QH 241 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 241 Length adjustment: 23 Effective length of query: 217 Effective length of database: 218 Effective search space: 47306 Effective search space used: 47306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory