Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate WP_061532833.1 CAter10_RS06910 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_001584165.1:WP_061532833.1 Length = 306 Score = 184 bits (468), Expect = 2e-51 Identities = 103/283 (36%), Positives = 167/283 (59%), Gaps = 10/283 (3%) Query: 21 LISVLVSVGVLNLF------YVQILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGA 74 L++ L + G L+ + Y ++ +G+N +LA+ + + + G SL +A FM IGA Sbjct: 4 LLTTLGATGFLDWWDGFWSTYNTVIFSLGVNAMLALSIYVTLS-CGLLSLANAAFMGIGA 62 Query: 75 YAAAIIGSKSPTYGAFFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIF 134 YAA++I ++ F A+ +G +L VAL++GIPTLRL G YLA+ATLG E++R+ Sbjct: 63 YAASLISMQTGL--PFPVALAIGGILPALVALMIGIPTLRLSGVYLAMATLGFGEVVRVI 120 Query: 135 IINGGSLTNGAAGILGIPNFTTWQMVYFFVVITTIATLNFLRSPIGRSTLSVREDEIAAE 194 ++N +T G G+ GIP T W + + T RS IGR+ +++EDE+AA Sbjct: 121 VLNM-DITGGPLGLNGIPLKTEWWHIVLLLAATLYILARIRRSKIGRAFEAIKEDEVAAR 179 Query: 195 SVGVNTTKIKIIAFVFGAITASIAGSLQAGFIGSVVPKDYTFINSINVLIIVVFGGLGSI 254 +GVN K++AFV GA A +AG L A + ++ P +Y F N++ +L + VFGG ++ Sbjct: 180 LMGVNVAGYKLLAFVIGAAIAGVAGGLNAHYTFTIGPGNYAFENAVEILTMAVFGGTSTL 239 Query: 255 TGAIVSAIVLGILNMLLQDVASVRMIIYALALVLVMIFRPGGL 297 G + ++L +L L+D S R ++ L LVLV+++ P G+ Sbjct: 240 IGPTLGGMILTLLPEALRDFDSYRSVVNGLILVLVILYLPKGI 282 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 306 Length adjustment: 27 Effective length of query: 291 Effective length of database: 279 Effective search space: 81189 Effective search space used: 81189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory