Align NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_061532833.1 CAter10_RS06910 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8YY08 (377 letters) >NCBI__GCF_001584165.1:WP_061532833.1 Length = 306 Score = 79.7 bits (195), Expect = 1e-19 Identities = 48/128 (37%), Positives = 73/128 (57%), Gaps = 16/128 (12%) Query: 11 STATFALFSLGLNLQWGFT-------GLINFGHIAFMTLGAYTTVLLSLK-GVPLFISAI 62 ST +FSLG+N + GL++ + AFM +GAY L+S++ G+P ++ Sbjct: 22 STYNTVIFSLGVNAMLALSIYVTLSCGLLSLANAAFMGIGAYAASLISMQTGLPFPVALA 81 Query: 63 VGAIFAALLGLVIGFATLRLREDYLAIVTIGTGELIRLVVNNQDLPVGDTWVSGAFGVQS 122 +G I AL+ L+IG TLRL YLA+ T+G GE++R++V N D+ G ++G Sbjct: 82 IGGILPALVALMIGIPTLRLSGVYLAMATLGFGEVVRVIVLNMDITGGPLGLNG------ 135 Query: 123 YPIPLSTE 130 IPL TE Sbjct: 136 --IPLKTE 141 Score = 76.6 bits (187), Expect = 8e-19 Identities = 55/183 (30%), Positives = 89/183 (48%), Gaps = 12/183 (6%) Query: 184 GVGIILGLLATAIYISGVITLYNYIPKAGLMLVSLLVLAFVFWRLEYLVRSPWGRVLKAI 243 G G ++ ++ + I+G N IP +L+LA + L + RS GR +AI Sbjct: 112 GFGEVVRVIVLNMDITGGPLGLNGIPLKTEWWHIVLLLAATLYILARIRRSKIGRAFEAI 171 Query: 244 REDEEIPKAMGKNVFWYKLQSLMLGGAIAGIAGAFFAWQISAIYPDNFQPQLTFDSWIMV 303 +EDE + MG NV YKL + ++G AIAG+AG A I P N+ + + M Sbjct: 172 KEDEVAARLMGVNVAGYKLLAFVIGAAIAGVAGGLNAHYTFTIGPGNYAFENAVEILTMA 231 Query: 304 ILGGAGNNIGSILGAVIYFAYDAITREVLPKIIPLDEARLGAFRIMCIGLILMVLMIWRP 363 + GG IG LG +I ++P ++R + GLIL++++++ P Sbjct: 232 VFGGTSTLIGPTLGGMIL------------TLLPEALRDFDSYRSVVNGLILVLVILYLP 279 Query: 364 QGI 366 +GI Sbjct: 280 KGI 282 Lambda K H 0.328 0.145 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 306 Length adjustment: 28 Effective length of query: 349 Effective length of database: 278 Effective search space: 97022 Effective search space used: 97022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory