Align KguT (characterized, see rationale)
to candidate WP_061533840.1 CAter10_RS13675 MFS transporter
Query= uniprot:A0A167V864 (425 letters) >NCBI__GCF_001584165.1:WP_061533840.1 Length = 432 Score = 213 bits (542), Expect = 9e-60 Identities = 125/414 (30%), Positives = 208/414 (50%), Gaps = 22/414 (5%) Query: 12 WYIMPIVFITYSLAYLDRANYGFAAASGMADDLHITPALSSLLGALFFLGYFFFQVPGAI 71 W ++P++F+ Y +YLDR N GFA M +DL + + L +FFLGYF F++P + Sbjct: 23 WRLLPLLFLCYVASYLDRVNVGFAKLQ-MLNDLKFSETVYGLGAGIFFLGYFIFEIPSNM 81 Query: 72 YAEKRSVKKLIFVSLILWGGLATLTGMVQSVSLLIAIRFLLGVVEAAVMPAMLIYLCHWF 131 + + I +I WG ++ V S +RFLLGV EA P +++YL +W+ Sbjct: 82 ILHRVGARLWIARIMITWGIISGAMIFVDSPGTFYVMRFLLGVAEAGFFPGVILYLTYWY 141 Query: 132 TRAERSRANTFLILGNPVTILWMSVVSGYLVKHFD-------WRWMFIIEGLPAVLWAFI 184 R + + G P++ + +SG+++K W+WMF++E +P+++ I Sbjct: 142 PAHRRGKMTALFMTGVPLSGVIGGPLSGWIMKAMPGVHGLAGWQWMFVLEAIPSLILGVI 201 Query: 185 WWRLVDDRPEQASWLKAQEKTALREALAAEQQGIKPVKNYREAFRSPKVIILSLQYFCWS 244 + DR A WL +EK L + AE + V + + F +PKV +++L YFC+ Sbjct: 202 VIFYLQDRIRGAKWLSEEEKVLLETQVQAETNQKQEV-SLGQMFANPKVWLMALIYFCFV 260 Query: 245 IGVYGFVLWLPSILKQAAALDIVTAGWLSAVPYLGAVLAMLGVSWASDRMQKRKRFVWPP 304 +G+YG WLP+I+K D G L+A+PY A +AM+ + ++D+ ++R+ V P Sbjct: 261 MGLYGVSFWLPTIIKTTGVTDTFNIGLLTAIPYASAAIAMILIGHSADKRRERRWHVAIP 320 Query: 305 LLIAALAFYGSYILGTEHFWWSYTLLVIAGACMYAPYG-----PFFAIVP-ELLPSNVAG 358 L+ ++ S + + + L+ A A G P F +P L A Sbjct: 321 ALLGSIGLVMSTV-------YDHNTLLAMSALTLATIGIITVLPLFWSLPTAFLGGAAAA 373 Query: 359 GAMALINSMGALGSFSGSWLVGYLNGVTGGPGASYLFMCGALLVAVALTAVLNP 412 +ALINS+G L F +LVG+L T + + +LL+ LT L+P Sbjct: 374 AGIALINSLGNLAGFVSPYLVGWLKDQTHSTNSGMFVLAASLLLGAMLTLSLSP 427 Lambda K H 0.328 0.140 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 629 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 432 Length adjustment: 32 Effective length of query: 393 Effective length of database: 400 Effective search space: 157200 Effective search space used: 157200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory