Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_061533629.1 CAter10_RS12280 branched-chain amino acid ABC transporter ATP-binding protein/permease
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_001584165.1:WP_061533629.1 Length = 661 Score = 197 bits (500), Expect = 6e-55 Identities = 105/256 (41%), Positives = 163/256 (63%) Query: 12 GSPESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPD 71 G+ ++LL + + FGGL+A++ ++ + +GS+ GLIGPNG+GK+T+ N+L+ +P Sbjct: 387 GAVGTTLLSGKQILMQFGGLKALNEVNLDIVKGSVHGLIGPNGSGKSTMMNVLTGIYKPT 446 Query: 72 QGEVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLI 131 G+V FNG +I P IAL G RTFQ ++ +T EN+L+ H L + Sbjct: 447 SGKVEFNGRTISGTTPSAIALGGVARTFQNVQLFGEMTATENVLVGLHHTFRSNMLDVVF 506 Query: 132 NFRRVQKEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLD 191 N R ++EE++ RE+A ++L+ VGL A + A L G+++LLE+ RAL NP+L+LLD Sbjct: 507 NTPRYRREEQSARERAASILQFVGLTDLATEEARNLPYGKQRLLEIGRALGLNPELLLLD 566 Query: 192 EPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPE 251 EPAAG+ I ++ I + GIT ++IEH+MDV+M++ V VL G+ +A+G P Sbjct: 567 EPAAGLTAPDIKELIAIIHKIRQHGITIILIEHHMDVVMSISDTVTVLDFGQKIAEGRPA 626 Query: 252 QIQSDPRVLEAYLGDS 267 +Q DP+V+EAYLG S Sbjct: 627 AVQVDPKVIEAYLGGS 642 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 399 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 661 Length adjustment: 31 Effective length of query: 236 Effective length of database: 630 Effective search space: 148680 Effective search space used: 148680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory