Align Peroxisomal multifunctional enzyme A; MFE-A; MFE-1; EC 1.1.1.35 (characterized)
to candidate WP_061533914.1 CAter10_RS14240 3-hydroxybutyrate dehydrogenase
Query= SwissProt::Q9NKW1 (441 letters) >NCBI__GCF_001584165.1:WP_061533914.1 Length = 260 Score = 105 bits (261), Expect = 2e-27 Identities = 72/212 (33%), Positives = 107/212 (50%), Gaps = 14/212 (6%) Query: 3 LNFKDKVVIVTGAGGGIGKVYALEFAKRGAKVVVNDLGGSHTGQGSSSKAADKVVEEIKA 62 ++ KDKV ++TG+ GIGK A+E+A+ GAKVV+ DL AA EI Sbjct: 1 MSLKDKVALITGSASGIGKEIAIEYARAGAKVVIADL---------QLDAATATANEITQ 51 Query: 63 AGGTAVANYDSVEDG---EKIVQTAMDSFGGVDILINNAGILRDVSFGKMTDGDWDLVYR 119 +GG A+A +V D +K + + ++G +D+LI+NAGI T +W + Sbjct: 52 SGGIAMAVAMNVTDETQVDKGIADTVAAYGSIDVLISNAGIQIIAPIVDSTLDNWKKMLA 111 Query: 120 VHAKGAYKLSRAAWNHMREK-NFGRIIMTSSAAGLYGNFGQANYGSMKMALVGLSNTLAQ 178 +H GAY +RAA M +K N G II S + +A Y + K L+GL+ +A+ Sbjct: 112 IHLDGAYLTTRAAMREMIKKGNGGSIIYMGSVHSHEASPLKAPYVTAKHGLIGLAKVVAK 171 Query: 179 EGKSKNIHCNTIAP-IAASRLTESVMPPEILE 209 EG I N I P + L E +P + E Sbjct: 172 EGAKNKIRANVICPGFVRTPLVEKQIPEQAKE 203 Lambda K H 0.313 0.131 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 260 Length adjustment: 28 Effective length of query: 413 Effective length of database: 232 Effective search space: 95816 Effective search space used: 95816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory