Align Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate WP_061533332.1 CAter10_RS10280 amino acid ABC transporter permease
Query= TCDB::Q9HU29 (230 letters) >NCBI__GCF_001584165.1:WP_061533332.1 Length = 250 Score = 110 bits (276), Expect = 2e-29 Identities = 76/242 (31%), Positives = 134/242 (55%), Gaps = 29/242 (11%) Query: 3 EWELILKWMPKMLQGAALTLELLAIAVVAGLALALPLGIARAS--RH----WYVR-AVPY 55 +W++I +++P ++G +TL++ I VV G L L LG+ R + RH +++R AV + Sbjct: 6 QWQIIGEYLPLFIEGTLMTLKVAVICVVTGTFLGLLLGVGRVAEARHGAMKYFLRYAVQW 65 Query: 56 A---YIFFFRGTPLLLQLFIVYY-----------GLAQFEEVRKSAFWPYLRDPYWCALL 101 Y+ FFRGTPL +Q+ ++++ GL ++ + Y + A+L Sbjct: 66 PVRFYVSFFRGTPLFVQILLIHFALMPLLINPNGGLLLSGDIAREVRSQY--GAFLSAVL 123 Query: 102 TMTLHTAAYIAEILRGAIHSVPVGEVEAARALGMSRRQALWHIILPRAVRIGLPAYSNEV 161 +TL++ AY++EI R I S+ G+ EA+R+LGM+ Q L ++LP+A R LP N Sbjct: 124 AITLNSGAYVSEIFRAGIQSIDRGQSEASRSLGMTYLQTLRKVVLPQAFRRMLPPLGNNA 183 Query: 162 ILMLKASAVVYTVTLFDIMGMARTI---IARTYESMLFFCLAGALYLVITIVLTRIFRLI 218 I ++K S++ + L ++ ART+ AR +E L L +Y IT++L+ + + Sbjct: 184 IAIVKDSSLASAIGLAELAYAARTVSGAYARYWEPYLTISL---IYWGITLLLSVFVQHL 240 Query: 219 ER 220 E+ Sbjct: 241 EK 242 Lambda K H 0.332 0.142 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 230 Length of database: 250 Length adjustment: 23 Effective length of query: 207 Effective length of database: 227 Effective search space: 46989 Effective search space used: 46989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory