Align ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, permease component 2 (characterized)
to candidate WP_061534159.1 CAter10_RS15795 sugar ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_3041 (299 letters) >NCBI__GCF_001584165.1:WP_061534159.1 Length = 309 Score = 386 bits (992), Expect = e-112 Identities = 187/287 (65%), Positives = 233/287 (81%), Gaps = 6/287 (2%) Query: 14 NPGWF-----LVSPSVALLLLWMIVPLGMTVYFSTIRYNLLNPGENEFVGLENFTYFLTD 68 NPG F L +PSV+LLLLWMIVPL MT+YFS IRYNL+ P E FVGL+N+ + L+D Sbjct: 18 NPGKFKAVRLLQAPSVSLLLLWMIVPLAMTLYFSVIRYNLMTPDETGFVGLDNYAFLLSD 77 Query: 69 SGFLPGATNTLLLVGSVLLISVVFGVLISALLEASEFFGRGIVRVMLISPFFIMPTVGAL 128 F P NTL+L+GSVL+ISVV G L++ L + FFGRGI R+++I PFF+MPTV AL Sbjct: 78 PAFWPSILNTLVLIGSVLVISVVGGTLLAVLFD-QPFFGRGIARLLVIGPFFVMPTVAAL 136 Query: 129 IWKNLIFHPVSGILAYVWKLFGAQPVDWLAHYPLLSIIIIVSWQWLPFAILILMTAMQSL 188 IWKN+I HPV G+LA+ +L G +PVDWLA YP+LS+I+IV+WQW+PFA LIL+TA+QSL Sbjct: 137 IWKNMILHPVYGLLAWAMRLVGLEPVDWLAEYPMLSVIMIVAWQWIPFAFLILLTALQSL 196 Query: 189 DQEQKEAARLDGAGPIAIFWHLTLPHLARPIAVVVMIETIFLLSVFAEIFTTTNGGPGYA 248 D EQKEAA+LDGAGPI +FW++ LPHL R I VV+MIETIFLLS+FAEIFTTT GGPG A Sbjct: 197 DTEQKEAAQLDGAGPIRVFWYVVLPHLKRAITVVIMIETIFLLSIFAEIFTTTAGGPGTA 256 Query: 249 STNLAYLIYNQALVQFDVGMASAGGLIAVVIANIAAIILVRMIGKNL 295 +TNLAYL+Y+ L QFD+G+ASAGG+IAVV+ANI + LVRM+ +NL Sbjct: 257 TTNLAYLVYSIGLQQFDIGIASAGGIIAVVLANIVSFFLVRMMARNL 303 Lambda K H 0.328 0.142 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 309 Length adjustment: 27 Effective length of query: 272 Effective length of database: 282 Effective search space: 76704 Effective search space used: 76704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory