Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_061532690.1 CAter10_RS05915 ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >NCBI__GCF_001584165.1:WP_061532690.1 Length = 348 Score = 205 bits (522), Expect = 1e-57 Identities = 125/336 (37%), Positives = 189/336 (56%), Gaps = 31/336 (9%) Query: 17 ARRSSSTTAQWLLHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQVAIN 76 AR T Q LL +L +LV F+ L + NF +N ++IL+ A+N Sbjct: 28 ARIFHPATRQKLLAFASLLALLV-----FFSLA-------SPNFLEIDNLVSILQSTAVN 75 Query: 77 LVLAAGMTFVILTAGIDLSVGSVLAVSAVL-GMQVSLGAAPGWAIPMF------IFSGLV 129 VLA TFVI+TAGIDLSVG+++ AV+ G+ ++ W +P++ I G + Sbjct: 76 GVLAIACTFVIITAGIDLSVGTLMTFCAVMAGVFLTY-----WGLPIYVGIAAAILFGAL 130 Query: 130 MGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLNNDIPSFEWIGNGDF---- 185 G V+G ++A L I F+ TLG M +G + +++ + ND P F I Sbjct: 131 CGWVSGVLIAKLKIPPFIATLGMMMLLKGLSLVISGTKPIYFNDTPGFSSISQDSLIGTL 190 Query: 186 ---LHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVLLFVYSI 242 L +P + + V + + + L K++ G + +A+G N +A RL+G+ V + VYS+ Sbjct: 191 IPALPIPNAVLILFLVAIAAGIALNKSIFGRYTFALGSNEEALRLSGVNVDFWKVTVYSV 250 Query: 243 SGLFSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVVGALIIG 302 SG G+AG + ASRL A G GYELDAIAAVV+GGTSL GG G+I GT++GA I+ Sbjct: 251 SGAICGIAGLLIASRLNSAQPALGQGYELDAIAAVVIGGTSLSGGTGTILGTIIGAFIMS 310 Query: 303 VMNNGLTILGLSSFWQYVAKGAVIVLAVILDKWRQK 338 V+ NGL ++ ++ WQ V G +I+LAV +D R++ Sbjct: 311 VLINGLRMMSVAQEWQTVVTGVIIILAVYMDILRRR 346 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 348 Length adjustment: 29 Effective length of query: 315 Effective length of database: 319 Effective search space: 100485 Effective search space used: 100485 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory