Align Inositol transport system permease protein (characterized)
to candidate WP_061533692.1 CAter10_RS12715 ABC transporter permease
Query= reanno::WCS417:GFF2333 (340 letters) >NCBI__GCF_001584165.1:WP_061533692.1 Length = 374 Score = 157 bits (396), Expect = 5e-43 Identities = 110/348 (31%), Positives = 180/348 (51%), Gaps = 11/348 (3%) Query: 1 MNAITDNKPATVPTKSRRRLPTELSIFLVLIGIGLVFELF---GWIVRDQSFLMNSQRLV 57 +++ N P +P++ L L L + + L + F G+ + L+ Sbjct: 15 LSSAASNTPQPLPSRLSHTLRHPLIRPLAALALLLAIDFFVIPGFFRMEWKDGHLYGSLI 74 Query: 58 LMILQVSIIGLLAIGVTQVIITTGIDLSSGSVLALSA-MIAASLAQTSDFSRAVFPSLTD 116 ++ + + + L A+G+T VI T GID+S G+V+A+S +IA + + V ++ Sbjct: 75 DIVNRAAPLILTALGMTLVIATRGIDISVGAVVAISGTVIALLIGGNVEMHNGVPQYVSQ 134 Query: 117 LPVWIPVAMGLGVGLLAGAINGSIIAVTGIPPFIATLGMMVSARGLARYYTEGQPVSMLS 176 +P+ +A +G +L GA NG ++A G+ P IATL +MV RGLA+ T+GQ +++ Sbjct: 135 IPMGWAIAAAMGAAILCGAWNGFLVATLGLQPIIATLILMVGGRGLAQLLTDGQIITVYY 194 Query: 177 DSYTAIGHG---AMPVIIFLVVAVIFHIAL--RYTKYGKYTYAIGGNMQAARTSGINVKR 231 + +G G +P +F+ + V +AL R T G + A+G N AAR +GI Sbjct: 195 KPFFYLGSGYLFGLPFSLFIAIGVFLIVALLMRKTALGLFIQAVGINPVAARLAGIRTAA 254 Query: 232 HLIIVYSIAGLLAGLAGVVASARAATGQA-GMGMSYELDAIAAAVIGGTSLAGGVGRITG 290 + VY AG+AG++ S+ + A G+ ELDAI A +GGTSLAGG + G Sbjct: 255 LIFFVYIFCSACAGVAGLLISSNIKSADANNAGLLLELDAILAVTLGGTSLAGGKFSLVG 314 Query: 291 TVIGALILGVMASGFTFVGVDAYIQDIIKGLIIVVAVVIDQYRNKRKL 338 +VIGALI+ + +GV + ++K I+V AV + Q R L Sbjct: 315 SVIGALIIQTLTYTIYSMGVPPEVNMVVKS-IVVFAVCLSQSPEFRHL 361 Lambda K H 0.325 0.140 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 374 Length adjustment: 29 Effective length of query: 311 Effective length of database: 345 Effective search space: 107295 Effective search space used: 107295 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory