Align Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate WP_061535202.1 CAter10_RS06725 hypothetical protein
Query= TCDB::B8H230 (332 letters) >NCBI__GCF_001584165.1:WP_061535202.1 Length = 330 Score = 211 bits (537), Expect = 2e-59 Identities = 122/299 (40%), Positives = 177/299 (59%), Gaps = 6/299 (2%) Query: 32 LLLLVAVFGAANERFLTARNALNILSEVSIYGIIAVGMTFVILIGGIDVAVGSLLAFASI 91 LLLL+ F ++ F T +N + + S+ ++A GMTFVIL GID++VG++LA Sbjct: 33 LLLLILGFSLLSQNFFTLQNLSIVTQQASVNIVLAAGMTFVILTAGIDLSVGAILA---- 88 Query: 92 AAAYVVTAVVGDGPATWLIALLVSTLIGLAGGYVQGKAVTWLHVPAFIVTLGGMTVWRGA 151 A+ VV + P ++ + GL G V G + ++ +P FIVTLG +T RG Sbjct: 89 -ASAVVAMLASMSPQYGMLGIAAGLGFGLLLGLVNGVLIAFMRLPPFIVTLGALTAMRGL 147 Query: 152 TLLLNDGGPISGFNDAYRWWGSGEILFLPVPVVIFALVAAAGHVALRYTRYGRQVYAVGG 211 LL D + + + G+ IL +P V+I LV A LR T G Q+YAVGG Sbjct: 148 ARLLADDKTVFNPELPFAFIGNDSILGVPWLVIIALLVVALAWFILRRTVIGVQIYAVGG 207 Query: 212 NAEAARLSGVNVDFITTSVYAIIGALAGLSGFLLSARLGSAEAV-AGTGYELRVIASVVI 270 NAEAARLSG+ V + VYA+ G LAGL + ++RL +A + G YEL IA+V++ Sbjct: 208 NAEAARLSGIKVWKVLLFVYAVSGLLAGLGAVMTASRLSAANGLQLGQSYELDAIAAVIL 267 Query: 271 GGASLTGGSGGVGGTVLGALLIGVLSNGLVMLHVTSYVQQVVIGLIIVAAVAFDHYART 329 GG S TGG G + GT++GAL+I VL+NGLV+L V+ Q ++ G++I+ AVA D Y ++ Sbjct: 268 GGTSFTGGVGSIVGTLIGALIIAVLTNGLVLLGVSDIWQYIIKGIVIIGAVALDRYRQS 326 Lambda K H 0.325 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 330 Length adjustment: 28 Effective length of query: 304 Effective length of database: 302 Effective search space: 91808 Effective search space used: 91808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory