Align Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate WP_061535474.1 CAter10_RS19695 ABC transporter permease
Query= TCDB::B8H230 (332 letters) >NCBI__GCF_001584165.1:WP_061535474.1 Length = 329 Score = 169 bits (427), Expect = 1e-46 Identities = 113/307 (36%), Positives = 173/307 (56%), Gaps = 25/307 (8%) Query: 32 LLLLVAVFGAANERFLTARNALNILSEVSIYGIIAVGMTFVILIGGIDVAVGSLLAFASI 91 LL + +F +E FLT + +++ ++AVGMTFV++IGGID++VGS++A + Sbjct: 31 LLAMCVLFSFLSENFLTLATFTTLSNDIPTLVVMAVGMTFVLIIGGIDLSVGSVMA---L 87 Query: 92 AAAYVVTAVVGDGPATW---LIALLVSTLIGLAGGYVQGKAVTWLHVPAFIVTLGGMTVW 148 AA+ + A+V G + ++A+LV++L G+ G + +V W +P+FIV+LG + + Sbjct: 88 AASVLSMAMVRWGWPLFGAGVLAVLVASLCGMVTGVI---SVGW-RIPSFIVSLGVLEMA 143 Query: 149 RGATLLLND------GGPISGFNDAYRWWGSGEILFLPVPVVIFA-LVAAAGHVALRYTR 201 RG + + G + G S IL P + A L+ GH+ L T Sbjct: 144 RGLAYQVTNSRTEYIGSAVDGI--------SSPILLGMSPAFLSAILIVIIGHLVLTKTV 195 Query: 202 YGRQVYAVGGNAEAARLSGVNVDFITTSVYAIIGALAGLSGFLLSARLGSAEAVAGTGYE 261 GR +G N EA RL+G+N V+A++G LAG+ +RL +A+ G G E Sbjct: 196 LGRHWIGIGTNEEAVRLAGINPRPSKVLVFALMGLLAGVGALFQVSRLEAADPNGGVGME 255 Query: 262 LRVIASVVIGGASLTGGSGGVGGTVLGALLIGVLSNGLVMLHVTSYVQQVVIGLIIVAAV 321 L+VIA+VVIGG SL GG G V T +G L+I VL GL + V+ ++++V GL+IVAAV Sbjct: 256 LQVIAAVVIGGTSLMGGRGSVISTFIGVLIISVLEAGLAQVGVSEPMKRIVTGLVIVAAV 315 Query: 322 AFDHYAR 328 D Y R Sbjct: 316 VLDTYRR 322 Lambda K H 0.325 0.140 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 329 Length adjustment: 28 Effective length of query: 304 Effective length of database: 301 Effective search space: 91504 Effective search space used: 91504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory