Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_061532833.1 CAter10_RS06910 branched-chain amino acid ABC transporter permease
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_001584165.1:WP_061532833.1 Length = 306 Score = 145 bits (367), Expect = 1e-39 Identities = 94/313 (30%), Positives = 157/313 (50%), Gaps = 63/313 (20%) Query: 40 VLLALGLNIVVGYA-------GLLDLGYVAFYAVGAYLFALMASPHLADNFAAFAAMFPN 92 V+ +LG+N ++ + GLL L AF +GAY +L++ FP Sbjct: 27 VIFSLGVNAMLALSIYVTLSCGLLSLANAAFMGIGAYAASLISMQT--------GLPFP- 77 Query: 93 GLHTSLWIVIPVAALLAAFFGAMLGAPTLKLRGDYLAIVTLGFGEIIRIFLNNLDHPVNL 152 + + + +L A M+G PTL+L G YLA+ TLGFGE++R+ + N+D + Sbjct: 78 -------VALAIGGILPALVALMIGIPTLRLSGVYLAMATLGFGEVVRVIVLNMD----I 126 Query: 153 TNGPKGLGQIDSVKVFGLDLGKRLEVFGFDINSVTLYYYLFLVLVVVSVIICYRLQDSRI 212 T GP GL I + ++ ++L+ ++ I R++ S+I Sbjct: 127 TGGPLGLNGIP----------------------LKTEWWHIVLLLAATLYILARIRRSKI 164 Query: 213 GRAWMAIREDEIAAKAMGINTRNMKLLAFGMGASFGGVSGAMFGAFQGFVSPESFSLMES 272 GRA+ AI+EDE+AA+ MG+N KLLAF +GA+ GV+G + + + P +++ + Sbjct: 165 GRAFEAIKEDEVAARLMGVNVAGYKLLAFVIGAAIAGVAGGLNAHYTFTIGPGNYAFENA 224 Query: 273 VMIVAMVVLGGIGHIPGVILGAVLLSALPEVLRYVAGPLQAMTDGRLDSAILRQLLIALA 332 V I+ M V GG + G LG ++L+ LPE LR D R ++ L Sbjct: 225 VEILTMAVFGGTSTLIGPTLGGMILTLLPEALR--------------DFDSYRSVVNGLI 270 Query: 333 MIIIMLLRPRGLW 345 +++++L P+G+W Sbjct: 271 LVLVILYLPKGIW 283 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 259 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 306 Length adjustment: 28 Effective length of query: 330 Effective length of database: 278 Effective search space: 91740 Effective search space used: 91740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory