Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; EC 2.3.1.9 (characterized)
to candidate WP_061532101.1 CAter10_RS02135 3-oxoadipyl-CoA thiolase
Query= SwissProt::Q0AVM3 (396 letters) >NCBI__GCF_001584165.1:WP_061532101.1 Length = 400 Score = 318 bits (815), Expect = 2e-91 Identities = 174/399 (43%), Positives = 248/399 (62%), Gaps = 11/399 (2%) Query: 4 EVVLVGACRTPVGTFGGTLKDVGSAQLGAIVMGEA-IKRAGIKAEQIDEVIFGCVLQAGL 62 + + A RTP+G +GG LKDV + LGA+ + ++ + ID+V+FGC QAG Sbjct: 3 DAFICDAIRTPIGRYGGALKDVRADDLGAVPLRALMVRNPQVDWSAIDDVVFGCANQAGE 62 Query: 63 -GQNVARQCMINAGIPKEVTAFTINKVCGSGLRAVSLAAQVIKAGDADIIMAGGTENMDK 121 +NVAR + AG+P++V TIN++CGSG+ AV AA+ I+AGD +++AGG E+M + Sbjct: 63 DNRNVARMSALLAGLPQQVPGSTINRLCGSGMDAVGSAARAIRAGDTGLMIAGGVESMTR 122 Query: 122 APFILPNARWGYRMSMPKGDLIDEMVWGGLTDVFNGYHMGI-----TAENINDMYGITRE 176 AP ++ A + + + D + + G+ TAEN+ D Y I+R Sbjct: 123 APMVMGKAETAFSRNAA---IYDTTIGWRFPNPLMVAQYGVDAMPETAENVADEYRISRA 179 Query: 177 EQDAFGFRSQTLAAQAIESGRFKDEIVPVVIKGKKGD-IVFDTDEHPRKSTPEAMAKLAP 235 +QD F SQT AA A ++G EI PVVI KKGD DEHPR ++ EA+AKL Sbjct: 180 DQDKFALASQTKAALAQQNGILAQEITPVVIAQKKGDPFSVSVDEHPRLTSLEALAKLKG 239 Query: 236 AFKKGGSVTAGNASGINDAAAAVIVMSKEKADELGIKPMAKVVSYASGGVDPSVMGLGPI 295 + GSVTAGNASGIND A A+++ + + P A++V A+ GV P VMG+GP Sbjct: 240 VVRADGSVTAGNASGINDGACALLLANSGAIARHNLTPRARIVGMATAGVAPRVMGIGPA 299 Query: 296 PASRKALEKAGLTIDDIDLIEANEAFAAQSIAVARDLGWADKMEKVNVNGGAIAIGHPIG 355 PA++K L + G++ID +D+IE NEAFA+Q +AV R LG D +VN NGGAIA+GHP+G Sbjct: 300 PATQKLLHQLGMSIDQMDVIELNEAFASQGLAVLRLLGLQDDDPRVNPNGGAIALGHPLG 359 Query: 356 SSGARILVTLLYEMQKRGSKKGLATLCIGGGMGTALIVE 394 SGAR++ T +Y++Q+ G + L T+CIG G G ALI+E Sbjct: 360 MSGARLVTTAMYQLQRSGGRYALCTMCIGVGQGIALIIE 398 Lambda K H 0.317 0.135 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 440 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 400 Length adjustment: 31 Effective length of query: 365 Effective length of database: 369 Effective search space: 134685 Effective search space used: 134685 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory