Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate WP_061532137.1 CAter10_RS02370 enoyl-CoA hydratase
Query= SwissProt::Q0AVM1 (260 letters) >NCBI__GCF_001584165.1:WP_061532137.1 Length = 254 Score = 117 bits (293), Expect = 2e-31 Identities = 81/255 (31%), Positives = 125/255 (49%), Gaps = 8/255 (3%) Query: 5 NIILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVNDDPAVELLIITGSGDKSFVA 64 +I+ KE + + NR + NA+ + DA+ D AV ++ G + F A Sbjct: 2 DILTSKENGILTIEFNRLEKKNAITAAMYQTMVDALKDAETDSAVRAILFVGK-PQIFSA 60 Query: 65 GADIA-FMQNL-SAMEAREFGALGQKVFRLIEAMEKPVIAAVNGFALGGGCELAMCCDFR 122 G D+ FM+N ++ ++ F L Q I KP++AAV G A+G G L M CD Sbjct: 61 GNDLEDFMKNRPNSPDSPVFQFLWQ-----ISHASKPMVAAVAGAAVGIGTTLLMHCDLV 115 Query: 123 IAASNAKFGQPEVGLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINADEAFRIGLVNKV 182 AA NA+F P LG+ P + LP++ G A + L + A+EA +GLVNKV Sbjct: 116 YAADNARFSMPFTQLGLCPEAASSLILPQIAGYQRAAEKLLLGEAFTAEEANAMGLVNKV 175 Query: 183 VQPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGMQTDIDRAMSIEADAFGLCFATQDQ 242 + PEELL + A ++++ ++R +K ++ M E D FG + + Sbjct: 176 LPPEELLAFAQAQAAKLVALPAASIRTTKRLMKGSQVAAVEARMKEEIDHFGAMLKSPEA 235 Query: 243 KEGMTAFLEKRKANF 257 E TAF EKR+ +F Sbjct: 236 AEAFTAFFEKRRPDF 250 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 254 Length adjustment: 24 Effective length of query: 236 Effective length of database: 230 Effective search space: 54280 Effective search space used: 54280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory