Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate WP_082797879.1 CAter10_RS11570 taurine ABC transporter permease TauC
Query= SwissProt::P14176 (354 letters) >NCBI__GCF_001584165.1:WP_082797879.1 Length = 288 Score = 90.5 bits (223), Expect = 5e-23 Identities = 59/179 (32%), Positives = 96/179 (53%), Gaps = 4/179 (2%) Query: 142 WSQAMVTLALVLTALLFCIVIGLPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVPIVM 201 W ++A VL ALL I +P+GI + S RA + PL++ + P YL IV+ Sbjct: 91 WQHTATSVARVLAALLLAIATAIPIGILIGLSNRARAVFDPLIEFYRPIPPLAYLPLIVI 150 Query: 202 LFGIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQMLFKVQLPLAM 261 FGIG + V++ + P+ T+ G+ +V + + A+++ GAS Q++ V LP A+ Sbjct: 151 WFGIGELSKVLLIYLAIFAPLAIATLHGVRRVDQNRLRAAQTLGASRWQLIRFVILPSAV 210 Query: 262 PTIMAGVNQTLMLALSMVVIASMI-AVGGLGQMVLRGIGRLDMGLATVGGVGIVILAII 319 P I+ GV L + S +V A +I A GLG M+ L + V +GI+++A+I Sbjct: 211 PDILTGVRIGLGVGWSTLVAAELIAATRGLGFMIQSAAQFL---VTDVVIMGILVIALI 266 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 288 Length adjustment: 28 Effective length of query: 326 Effective length of database: 260 Effective search space: 84760 Effective search space used: 84760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory