Align Ribose ABC transport system, permease protein RbsC (characterized, see rationale)
to candidate WP_061535474.1 CAter10_RS19695 ABC transporter permease
Query= uniprot:A0A0C4Y7K0 (337 letters) >NCBI__GCF_001584165.1:WP_061535474.1 Length = 329 Score = 207 bits (526), Expect = 4e-58 Identities = 128/314 (40%), Positives = 187/314 (59%), Gaps = 19/314 (6%) Query: 33 LGMLPVLVLLCIGFSVLTENFAGWQNLSIIAQQASINMVLAAGMTFVILTGGIDLSVGSI 92 LG++ L+ +C+ FS L+ENF + ++ +V+A GMTFV++ GGIDLSVGS+ Sbjct: 25 LGLIGALLAMCVLFSFLSENFLTLATFTTLSNDIPTLVVMAVGMTFVLIIGGIDLSVGSV 84 Query: 93 LSISAVVAMLVSL-----MPQLGMLSVPAALLCGLLFGIVNGALVAFMKLPPFIVTLGTL 147 ++++A V + + + G+L+V A LCG++ G+++ ++P FIV+LG L Sbjct: 85 MALAASVLSMAMVRWGWPLFGAGVLAVLVASLCGMVTGVISVG----WRIPSFIVSLGVL 140 Query: 148 TAVRGLARLVGNDSTIYNPDIGFAFIGNGE--VLGVPWLVIIAFAVVAVSWFVLRRTVLG 205 RGLA V N T Y IG A G +LG+ + A +V + VL +TVLG Sbjct: 141 EMARGLAYQVTNSRTEY---IGSAVDGISSPILLGMSPAFLSAILIVIIGHLVLTKTVLG 197 Query: 206 LQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAA--NGLQLGQSY 263 +G N EA RL+GI + V+A+ GLLAG+G + +RL AA NG G Sbjct: 198 RHWIGIGTNEEAVRLAGINPRPSKVLVFALMGLLAGVGALFQVSRLEAADPNG---GVGM 254 Query: 264 ELDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLVIIGA 323 EL IAAV++GGTS +GG GS++ T +G LII+VL GL +GVS+ + I+ GLVI+ A Sbjct: 255 ELQVIAAVVIGGTSLMGGRGSVISTFIGVLIISVLEAGLAQVGVSEPMKRIVTGLVIVAA 314 Query: 324 VALDSYRRKGSART 337 V LD+YRR+G T Sbjct: 315 VVLDTYRRRGERTT 328 Lambda K H 0.325 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 329 Length adjustment: 28 Effective length of query: 309 Effective length of database: 301 Effective search space: 93009 Effective search space used: 93009 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory