Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_061532834.1 CAter10_RS06915 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_001584165.1:WP_061532834.1 Length = 293 Score = 188 bits (478), Expect = 1e-52 Identities = 108/297 (36%), Positives = 169/297 (56%), Gaps = 17/297 (5%) Query: 9 QQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLDSV 68 QQL+N L++GS YAL A+G+T+V+G++G+IN +HG ++M+GSY A + + LA+ Sbjct: 4 QQLINALSLGSVYALFALGFTLVFGVLGVINLSHGAIFMLGSYAALLLVEHLAL------ 57 Query: 69 PLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGN--RLIPLISAIGMSIFLQNAV--MLS 124 PL + A A+++ + G +++ + RPLR N L P+I+ IG++ L + + Sbjct: 58 PLWL--AMLAAMLASGLLGLAVDYLVLRPLRARNAPHLAPMIATIGVATILTSLAQGLFG 115 Query: 125 QDSKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACR 184 +SK + T+ ++ +G + V Q I V++F++M L + R++LGRA R Sbjct: 116 AESKRFPVGTIPEESYNWGNLHVTAV-----QTGIVVISFILMLVLLAVMRRTQLGRALR 170 Query: 185 ACAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKAFTA 244 A AE K LLGIN + LT AAL A VL+G+ + I P +G K Sbjct: 171 AIAESPKAAYLLGINVEGLFYLTSFAAAALGGAAGVLVGLSFNAITPFMGQPMLHKGIAV 230 Query: 245 AVLGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILGR 301 +LGG+G I GAM+ GL LG AE ++D V FGLL L+LL +P+G+ G+ Sbjct: 231 IILGGMGDIRGAMIAGLFLGFAEVLTVAYISSDFRDAVGFGLLFLILLVKPSGMFGK 287 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 293 Length adjustment: 27 Effective length of query: 280 Effective length of database: 266 Effective search space: 74480 Effective search space used: 74480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory