Align Trehalose/maltose transport system permease protein MalF (characterized)
to candidate WP_061534159.1 CAter10_RS15795 sugar ABC transporter permease
Query= SwissProt::O51924 (295 letters) >NCBI__GCF_001584165.1:WP_061534159.1 Length = 309 Score = 139 bits (351), Expect = 6e-38 Identities = 90/275 (32%), Positives = 151/275 (54%), Gaps = 13/275 (4%) Query: 19 LMILPLLTVVLVFIILPVMGTFWISLHRDVTFIPEKP-FVGLRNYLRVLSAREFWYSTFV 77 L+ P ++++L+++I+P+ T + S+ R P++ FVGL NY +LS FW S Sbjct: 27 LLQAPSVSLLLLWMIVPLAMTLYFSVIRYNLMTPDETGFVGLDNYAFLLSDPAFWPSILN 86 Query: 78 TVSFSFVSVSLETILGLSFALILNERLKGRGVLRAIVLIPWAVPTIISARTWELMYNYS- 136 T+ + + + G A++ ++ GRG+ R +V+ P+ V ++A W+ M + Sbjct: 87 TLVLIGSVLVISVVGGTLLAVLFDQPFFGRGIARLLVIGPFFVMPTVAALIWKNMILHPV 146 Query: 137 YGLFNWILSILGVSPVNWLGTPISAFFAIVIADVWKTTPFMTLLLLAGLQAIPQDLYEAA 196 YGL W + ++G+ PV+WL ++++ W+ PF L+LL LQ++ + EAA Sbjct: 147 YGLLAWAMRLVGLEPVDWLAE--YPMLSVIMIVAWQWIPFAFLILLTALQSLDTEQKEAA 204 Query: 197 LIDGASMFERFKSITLPLLKPVLIVALILRTIDALRVFDIIYVLTGGGPGGATTSISLLA 256 +DGA F + LP LK + V +++ TI L +F I+ T GGPG ATT+ LA Sbjct: 205 QLDGAGPIRVFWYVVLPHLKRAITVVIMIETIFLLSIFAEIFTTTAGGPGTATTN---LA 261 Query: 257 FNYYNLG----DYGIGSAISILTFVL--VLSFTIV 285 + Y++G D GI SA I+ VL ++SF +V Sbjct: 262 YLVYSIGLQQFDIGIASAGGIIAVVLANIVSFFLV 296 Lambda K H 0.329 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 309 Length adjustment: 27 Effective length of query: 268 Effective length of database: 282 Effective search space: 75576 Effective search space used: 75576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory