Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate WP_061534662.1 CAter10_RS19070 long-chain fatty acid--CoA ligase
Query= SwissProt::P39062 (572 letters) >NCBI__GCF_001584165.1:WP_061534662.1 Length = 564 Score = 149 bits (375), Expect = 4e-40 Identities = 136/523 (26%), Positives = 231/523 (44%), Gaps = 60/523 (11%) Query: 75 TFKEMKEESNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAIKIGAIAGPLFEAFM 134 T+ E+ + S + G L+ G ++KG RV I MP + + ++ G + + Sbjct: 50 TYAEVDQLSRKVGAWLQAKG-LQKGARVAIMMPNVLQYPVAIAAILRAGYTVVNVNPLYT 108 Query: 135 EGAVKDRLENSEAKVVVTTPELLERIP-VDKLPHLQHVFVVGGEAESGTN--IIN----- 186 ++ +L +S A+ + + V ++HV V G ++N Sbjct: 109 PRELEHQLNDSGAEAIFILENFATTLQQVVARTKIKHVVVASMGDLMGVKGLLVNLVVRH 168 Query: 187 ---------------YDEAAKQEST-RLDIEWMDKKDGFLLHYTSGSTGTPKGVLHVHEA 230 ++ Q S+ +L + D L YT G+TG KG H Sbjct: 169 VKKMVPSFSLPGSVPFNTVLSQASSMQLKPVALTPDDVAFLQYTGGTTGVSKGATLSHRN 228 Query: 231 MIQQY-QTGKWVLD-----LKEEDIYWCTADPGWVTGTVYGIFAPWL-------NGATNV 277 ++ Q W+ K E + + A P +Y IFA + GA N+ Sbjct: 229 VVANVLQAEAWLSPGLAKGPKVEQLAFVCALP------LYHIFALTVCGMLGMREGALNL 282 Query: 278 IVGGRFSPESWYGTIEQLG---VNVWYSAPTAFRMLMGAGDEMAAKYDLTSLRHVLSVGE 334 ++ +P G I+++ +N + + T + L+ D AK D + R + G Sbjct: 283 LIP---NPRDIAGLIKEMSKYQINTFPAVNTLYNALLHHPD--FAKLDFSGYRVCVGGGM 337 Query: 335 PLNPEVIRWGHKVFNKRIHDTWWMTETGSQLICNYPCMDIK-PGSMGKPIPGVEAAIVDN 393 + V +V I + + ++ET S + C PC + G++G P+P E AI+D+ Sbjct: 338 AVQKAVADKWMEVTGCPIIEGYGLSET-SPIACANPCTITEYSGTIGLPLPSTEIAILDD 396 Query: 394 QGNELPPYRMGNLAIKKGWPSMMHTIWNNPEKYESYFMPGGWYVSGDSAYMDEEGYFWFQ 453 GN +P + G +AI+ P +M WN P++ P G++ SGD MDE GY Sbjct: 397 AGNPVPLGQPGEIAIRG--PQVMSGYWNRPDETAKVMTPDGFFKSGDIGVMDERGYTKIV 454 Query: 454 GRVDDVIMTSGERVGPFEVESKLVEHPAIAEAGVIGKPDPVRGEIIKAFIALREGFEPSD 513 R D+I+ SG V P EVE +V+HP + E +G PD GE++K F+ ++ Sbjct: 455 DRKKDMILVSGFNVYPNEVEGVVVQHPGVLECACVGVPDEHAGEVVKIFVVRKD----PA 510 Query: 514 KLKEEIRLFVKQGLAAHAAPREIEFKDKLPKTRSGKIMRRVLK 556 E++ + ++ L + P+ IEF+ +LPKT GKI+RR L+ Sbjct: 511 LTAEQLMAYCREQLTGYKRPKYIEFRTELPKTNVGKILRRELR 553 Lambda K H 0.318 0.136 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 774 Number of extensions: 47 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 572 Length of database: 564 Length adjustment: 36 Effective length of query: 536 Effective length of database: 528 Effective search space: 283008 Effective search space used: 283008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory